{ "uniprot_canonical_ac": "F1LT90-1", "uniprot_ac": "F1LT90", "uniprot_id": "F1LT90_RAT", "mass": { "chemical_mass": 69892.0, "monoisotopic_mass": 69892.0 }, "refseq": {}, "gene_names": [ { "name": "Zcwpw1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/F1LT90", "id": "F1LT90" } ], "protein_names": [ { "name": "Similar to Zinc finger, CW type with PWWP domain 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "F1LT90" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "F1LT90", "url": "https://www.uniprot.org/uniprot/F1LT90" } ], "common_name": "Rat" } ], "gene": [ { "name": "Zcwpw1", "url": "https://www.uniprot.org/uniprot/F1LT90", "locus": { "chromosome": "12", "start_pos": 18880633, "end_pos": 18910711, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000052199", "url": "https://www.ensembl.org/id/ENSRNOG00000052199" } ] } } ], "crossref": [ { "id": "ENSRNOG00000050128", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000050128", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "ENSRNOG00000052199", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000052199", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd20145", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20145", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000313", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000313", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011124", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011124", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042778", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042778", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "CAQPIRC", "url": "https://omabrowser.org/oma/group/CAQPIRC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR15999", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15999", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15999:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15999:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00855", "url": "http://pfam.xfam.org/family/PF00855", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07496", "url": "http://pfam.xfam.org/family/PF07496", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_003751196", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003751196", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1305405", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1305405", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "F1LT90", "url": "https://www.uniprot.org/uniprot/F1LT90", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1LT90-1", "url": "https://www.uniprot.org/uniprot/F1LT90-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0RC55", "url": "https://www.uniprot.org/uniprot/M0RC55", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0RC55-1", "url": "https://www.uniprot.org/uniprot/M0RC55-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAALQSHREYEKGTKKTFAPPTQKSHIEKPRPNSWKEDTPGTSSLEAETKPSLLKASLKKKQKATTEHGPSRGQEKKQKAHDQPAEKKGKEKTLTSAEFEEIFQIVLQKSLQECLETSCIQRIRPTKSDKEPGIAPSATDKENADPEKVITPDTPDIASSVEEGVNSEMGTSSLCQPGTEPSKKKWDRRSLSKQKKKAEDEKMEKIQDERECTLKEKQKIMIRDQKEEEGSFGHCVIWVQCSSPKCEKWRQLRGDIDPSVLPDDWSCDQNPDLNYNRCDIPEESWTGCESDVAYASYVPGSIVWAKQYGYPWWPGMIECDPDLGEYFLFASHLDSLPSKYHVTFFGEAVSRAWIPVRMLKNFQELSLELARLKKCKNKDSTQKLEAAISMAHRAEQINIQERVNLFGFWSRYNGADIGEGKDWMLCESNSPESCLEKEEKNSEEEKEEEGGKKDPTLPRPKPAKIQRKRPKSRGPVGGQDGTPKKKTVKKSLVSESTVPPGPTLRGKEEQGNSDLDHPGPKKKFKAPENKASVNNLSEEKEIKIVSKCPAPPAQHGVYTLGKDGLEPQVPLTQGATSFPPDDDGSSDLDLEQLMEDIGEPEERGEMQQRGSSEEFLAALFEE", "length": 622, "header": "tr|F1LT90-1|F1LT90_RAT Isoform 1 of Similar to Zinc finger, CW type with PWWP domain 1 OS=Rattus norvegicus OX=10116 GN=Zcwpw1 PE=4 SV=4 CANONICAL=F1LT90-1" }, "isoforms": [ { "isoform_ac": "F1LT90-1", "url": "", "sequence": { "sequence": "MAALQSHREYEKGTKKTFAPPTQKSHIEKPRPNSWKEDTPGTSSLEAETKPSLLKASLKKKQKATTEHGPSRGQEKKQKAHDQPAEKKGKEKTLTSAEFEEIFQIVLQKSLQECLETSCIQRIRPTKSDKEPGIAPSATDKENADPEKVITPDTPDIASSVEEGVNSEMGTSSLCQPGTEPSKKKWDRRSLSKQKKKAEDEKMEKIQDERECTLKEKQKIMIRDQKEEEGSFGHCVIWVQCSSPKCEKWRQLRGDIDPSVLPDDWSCDQNPDLNYNRCDIPEESWTGCESDVAYASYVPGSIVWAKQYGYPWWPGMIECDPDLGEYFLFASHLDSLPSKYHVTFFGEAVSRAWIPVRMLKNFQELSLELARLKKCKNKDSTQKLEAAISMAHRAEQINIQERVNLFGFWSRYNGADIGEGKDWMLCESNSPESCLEKEEKNSEEEKEEEGGKKDPTLPRPKPAKIQRKRPKSRGPVGGQDGTPKKKTVKKSLVSESTVPPGPTLRGKEEQGNSDLDHPGPKKKFKAPENKASVNNLSEEKEIKIVSKCPAPPAQHGVYTLGKDGLEPQVPLTQGATSFPPDDDGSSDLDLEQLMEDIGEPEERGEMQQRGSSEEFLAALFEE", "length": 622, "header": "tr|F1LT90-1|F1LT90_RAT Isoform 1 of Similar to Zinc finger, CW type with PWWP domain 1 OS=Rattus norvegicus OX=10116 GN=Zcwpw1 PE=4 SV=4 CANONICAL=F1LT90-1" }, "locus": { "chromosome": "12", "start_pos": 18903602, "end_pos": 18880775, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000065866.4", "url": "https://www.ensembl.org/id/ENSRNOT00000065866.4" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000062266.4", "url": "https://www.ensembl.org/id/ENSRNOP00000062266.4" } ] } }, { "isoform_ac": "M0RC55-1", "url": "", "sequence": { "sequence": "MPLKKYKVLQGTKKTFAPPTQKSHIEKPRPNSWKEDTPGTSSLEAETKPSLLKASLKKKQKATTEHGPSRGQEKKQKAHDQPAEKKGKEKTLTSAEFEEIFQIVLQKSLQECLETSCIQRIRPTKSDKEPGIAPSATDKENADPEKVITPDTPDIASSVEEGVNSEMGTSSLCQPGTEPSKKKWDRRSLSKQKKKAEDEKMEKIQDERECTLKEKQKIMIRDQKEEEGSFGHCVIWVQCSSPKCEKWRQLRGDIDPSVLPDDWSCDQNPDLNYNRCDIPEESWTGCESDVAYASYVPGSIVWAKQYGYPWWPGMIECDPDLGEYFLFASHLDSLPVSFLVLAQEGVPQKTNNRGLYQYQELKHLQLRECLSQKKCKNKDSTQKLEAAISMAHRAEQINIQERVNLFGFWSRYNGADIGEGKVSQFNLPFSVLSLLKDPTLPRPKPAKIQRKRPKSRGPVGGQDGTPKKKTVKKSLVSESTVPPGPTLRGKEEQGNSDLDHPGPKKKFKAPENKASVNNLSEEKEIKIVSKCPAPPAQHGVYTLGKDGLEPQVPLTQGATSFPPDDDGSSDLDLEQLMEDIGEPEERGEMQQRGSSEEFLAALFEE", "length": 605, "header": "tr|M0RC55-1|F1LT90_RAT Computationally mapped isoform of Similar to Zinc finger, CW type with PWWP domain 1 OS=Rattus norvegicus OX=10116 GN=Zcwpw1 PE=4 SV=3 CANONICAL=F1LT90-1" }, "locus": { "chromosome": "12", "start_pos": 18903118, "end_pos": 18880775, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000071110.4", "url": "https://www.ensembl.org/id/ENSRNOT00000071110.4" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000067164.3", "url": "https://www.ensembl.org/id/ENSRNOP00000067164.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nat. Commun.", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "M0RC55", "url": "https://www.uniprot.org/uniprot/M0RC55" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "F1LT90", "url": "https://www.uniprot.org/uniprot/F1LT90" } ], "pmid": "" }, { "name": "XY body", "id": "GO:0001741", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001741", "evidence": [ { "database": "UniProtKB", "id": "F1LT90", "url": "https://www.uniprot.org/uniprot/F1LT90" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "spermatogenesis", "id": "GO:0007283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "database": "UniProtKB", "id": "F1LT90", "url": "https://www.uniprot.org/uniprot/F1LT90" } ], "pmid": "" }, { "name": "homologous chromosome pairing at meiosis", "id": "GO:0007129", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007129", "evidence": [ { "database": "UniProtKB", "id": "F1LT90", "url": "https://www.uniprot.org/uniprot/F1LT90" } ], "pmid": "" }, { "name": "positive regulation of double-strand break repair", "id": "GO:2000781", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000781", "evidence": [ { "database": "UniProtKB", "id": "F1LT90", "url": "https://www.uniprot.org/uniprot/F1LT90" } ], "pmid": "" }, { "name": "meiosis I", "id": "GO:0007127", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007127", "evidence": [ { "database": "UniProtKB", "id": "F1LT90", "url": "https://www.uniprot.org/uniprot/F1LT90" } ], "pmid": "" }, { "name": "positive regulation of DNA recombination", "id": "GO:0045911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045911", "evidence": [ { "database": "UniProtKB", "id": "F1LT90", "url": "https://www.uniprot.org/uniprot/F1LT90" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "F1LT90", "url": "https://www.uniprot.org/uniprot/F1LT90" } ], "pmid": "" }, { "name": "methyl-CpG binding", "id": "GO:0008327", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008327", "evidence": [ { "database": "UniProtKB", "id": "F1LT90", "url": "https://www.uniprot.org/uniprot/F1LT90" } ], "pmid": "" }, { "name": "methylated histone binding", "id": "GO:0035064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035064", "evidence": [ { "database": "UniProtKB", "id": "F1LT90", "url": "https://www.uniprot.org/uniprot/F1LT90" } ], "pmid": "" }, { "name": "histone reader activity", "id": "GO:0140566", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140566", "evidence": [ { "database": "UniProtKB", "id": "F1LT90", "url": "https://www.uniprot.org/uniprot/F1LT90" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 535, "end_pos": 537, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }