{ "uniprot_canonical_ac": "E9Q9A9-1", "uniprot_ac": "E9Q9A9", "uniprot_id": "OAS2_MOUSE", "mass": { "chemical_mass": 85051.0, "monoisotopic_mass": 85051.0 }, "refseq": { "ac": "NP_001334377", "name": "2'-5'-oligoadenylate synthase 2 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334377" }, "gene_names": [ { "name": "Oas2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/E9Q9A9", "id": "E9Q9A9" }, { "name": "Oas2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334377", "id": "NP_001334377" }, { "name": "Oasl11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334377", "id": "NP_001334377" }, { "name": "oasl11", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/E9Q9A9", "id": "E9Q9A9" } ], "protein_names": [ { "name": "2'-5'-oligoadenylate synthase 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "E9Q9A9" }, { "name": "(2-5')oligo(A) synthase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "E9Q9A9" }, { "name": "2',5'-oligoadenylate synthetase-like 11", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "E9Q9A9" }, { "name": "2'-5'-oligoadenylate synthase 2 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334377", "id": "NP_001334377" }, { "name": "2,5-oligoadenylate synthetase-like 11; 2-5A synthase 2; (2-5')oligo(A) synthase 2; 2',5'-oligoadenylate synthetase-like 11; 2'-5'-oligoadenylate synthase 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334377", "id": "NP_001334377" }, { "name": "2-5A synthase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "E9Q9A9" }, { "name": "2.7.7.84", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "E9Q9A9" } ], "function": [ { "annotation": "A non-synonymous mutation in Oas2 (I405N) in the viral sensor Oas2 was found and the mutation caused post-partum failure of lactation in healthy mice with otherwise normally developed mammary glands, characterized by greatly reduced milk protein synthesis coupled with epithelial cell death, inhibition of proliferation and a robust interferon response. The mutation activates the OAS2 pathway. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001334377", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334377" }, { "database": "PubMed", "id": "29117179", "url": "https://glygen.org/publication/PubMed/29117179" } ] }, { "annotation": "Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response (PubMed:12396720, PubMed:29117179). Activated by detection of double stranded RNA (dsRNA): polymerizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNASEL) leading to its dimerization and subsequent activation (PubMed:29117179). Activation of RNASEL leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication (PubMed:21142819). Can mediate the antiviral effect via the classical RNASEL-dependent pathway or an alternative antiviral pathway independent of RNASEL (PubMed:21142819). In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation (PubMed:21142819). May act as a negative regulator of lactation, stopping lactation in virally infected mammary gland lobules, thereby preventing transmission of viruses to neonates (PubMed:29117179). Non-infected lobules would not be affected, allowing efficient pup feeding during infection (PubMed:29117179).", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9#function" }, { "database": "PubMed", "id": "12396720", "url": "https://glygen.org/publication/PubMed/12396720" }, { "database": "PubMed", "id": "15865429", "url": "https://glygen.org/publication/PubMed/15865429" }, { "database": "PubMed", "id": "29117179", "url": "https://glygen.org/publication/PubMed/29117179" }, { "database": "PubMed", "id": "21142819", "url": "https://glygen.org/publication/PubMed/21142819" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 405, "end_pos": 405, "sequence_org": "I", "sequence_mut": "N", "comment": "Mice display postpartum failure of lactation and strongly reduced milk protein synthesis. Otherwise, mice develop normally and mammary glands are normal. The mutation causes an activation of the OAS2 pathway, characterized by a strong increase of Ribonuclease L (RNASEL) activity.", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" }, { "database": "PubMed", "id": "29117179", "url": "https://glygen.org/publication/PubMed/29117179" } ] }, { "start_pos": 444, "end_pos": 444, "sequence_org": "K", "sequence_mut": "A", "comment": "Strongly reduced 2'-5'-oligoadenylate synthase activity.", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" }, { "database": "PubMed", "id": "15865429", "url": "https://glygen.org/publication/PubMed/15865429" } ] }, { "start_pos": 444, "end_pos": 444, "sequence_org": "K", "sequence_mut": "G", "comment": "Strongly reduced 2'-5'-oligoadenylate synthase activity.", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" }, { "database": "PubMed", "id": "15865429", "url": "https://glygen.org/publication/PubMed/15865429" } ] }, { "start_pos": 509, "end_pos": 509, "sequence_org": "S", "sequence_mut": "L", "comment": "Abolished 2'-5'-oligoadenylate synthase activity.", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" }, { "database": "PubMed", "id": "15865429", "url": "https://glygen.org/publication/PubMed/15865429" } ] }, { "start_pos": 538, "end_pos": 538, "sequence_org": "P", "sequence_mut": "L", "comment": "Strongly reduced 2'-5'-oligoadenylate synthase activity.", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" }, { "database": "PubMed", "id": "15865429", "url": "https://glygen.org/publication/PubMed/15865429" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Oas2", "url": "https://www.uniprot.org/uniprot/E9Q9A9", "locus": { "chromosome": "5", "start_pos": 120868398, "end_pos": 120887918, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000032690", "url": "https://www.ensembl.org/id/ENSMUSG00000032690" } ] } } ], "crossref": [ { "id": "ENSMUSG00000032690", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000032690", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd05400", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05400", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "246728", "url": "https://www.ncbi.nlm.nih.gov/gene/246728", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002934", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002934", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006116", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006116", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006117", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006117", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018952", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018952", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043518", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043518", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043519", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043519", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:246728", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:246728", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2180852", "url": "http://www.informatics.jax.org/marker/MGI:2180852", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "KQCERKM", "url": "https://omabrowser.org/oma/group/KQCERKM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4638494at2759", "url": "http://www.orthodb.org/?query=4638494at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11258", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11258", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11258:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11258:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01909", "url": "http://pfam.xfam.org/family/PF01909", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF10421", "url": "http://pfam.xfam.org/family/PF10421", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF18144", "url": "http://pfam.xfam.org/family/PF18144", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_E9Q9A9", "url": "http://purl.obolibrary.org/obo/PR_E9Q9A9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001334377", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334377", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "34407", "url": "https://www.rhea-db.org/rhea/34407", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q9A9-1", "url": "https://www.uniprot.org/uniprot/E9Q9A9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q9A9-2", "url": "https://www.uniprot.org/uniprot/E9Q9A9-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7CFL3", "url": "https://www.uniprot.org/uniprot/F7CFL3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7CFL3-1", "url": "https://www.uniprot.org/uniprot/F7CFL3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGNWLTGNWSSDRSSGYSSGWSPGGSSGVPSGPVHKLEKSIQANLTPNENCLKQIAVSSVPSQKLEGYIQENLKPNRESLKQIDQAVDAIWDLLRSQIPVKEVAKGGSYGRETALRGCSDGTLVLFMDCFQQFQDQIKYQDAYLDVIELWLKIHEKKSVKHEHALVVQVSVPGQRILLQLLPVFNPLRSNENPSSCVYVDLKKSMDQVRASPGEFSDCFTTLQQRFFKKYPQRLKDLILLVKHWYEQCQEKWKTPPPQPLLYALELLTVYAWEQGCQAEDFDMAQGVRTVLRLIQRPTELCVYWTVNYNFEDETVRNILLHQLRSQRPVILDPTDPTNNVGKDDGFWELLTEEAMAWLYSPSLNTESPAPYWDVLPMPLFVTPSHLLNKFIKDFLQPNKLFLKQIKEAVDIICSFLKNVCFLNSDTKVLKTVKGGSTAKGTALKRGSDADIVVFLSSLESYDSLKTNRSQFVQEIQKQLEEFVQAQEWEVTFEISKWKAPRVLSFTLKSKTLNESVEFDVLPAYDALGQLRSDFTLRPEAYKDLIELCASQDIKEGEFSICFTELQRNFIQTRPTKLKSLLRLIKHWYKQYERKMKPKASLPPKYALELLTVYAWEQGSGTDDFDIAEGFRTVLDLVIKYRQLCIFWTVNYNFEEEYMRKFLLTQIQKKRPVILDPADPTGDVGGGDRWCWHLLAEEAKEWLSSPCFQVEQKGLVQPWKVPVMQTPGSCGGQIYPTVGGVTK", "length": 742, "header": "sp|E9Q9A9-1|OAS2_MOUSE Isoform 1 of 2'-5'-oligoadenylate synthase 2 OS=Mus musculus OX=10090 GN=Oas2 PE=1 SV=1 CANONICAL=E9Q9A9-1" }, "isoforms": [ { "isoform_ac": "E9Q9A9-1", "url": "", "sequence": { "sequence": "MGNWLTGNWSSDRSSGYSSGWSPGGSSGVPSGPVHKLEKSIQANLTPNENCLKQIAVSSVPSQKLEGYIQENLKPNRESLKQIDQAVDAIWDLLRSQIPVKEVAKGGSYGRETALRGCSDGTLVLFMDCFQQFQDQIKYQDAYLDVIELWLKIHEKKSVKHEHALVVQVSVPGQRILLQLLPVFNPLRSNENPSSCVYVDLKKSMDQVRASPGEFSDCFTTLQQRFFKKYPQRLKDLILLVKHWYEQCQEKWKTPPPQPLLYALELLTVYAWEQGCQAEDFDMAQGVRTVLRLIQRPTELCVYWTVNYNFEDETVRNILLHQLRSQRPVILDPTDPTNNVGKDDGFWELLTEEAMAWLYSPSLNTESPAPYWDVLPMPLFVTPSHLLNKFIKDFLQPNKLFLKQIKEAVDIICSFLKNVCFLNSDTKVLKTVKGGSTAKGTALKRGSDADIVVFLSSLESYDSLKTNRSQFVQEIQKQLEEFVQAQEWEVTFEISKWKAPRVLSFTLKSKTLNESVEFDVLPAYDALGQLRSDFTLRPEAYKDLIELCASQDIKEGEFSICFTELQRNFIQTRPTKLKSLLRLIKHWYKQYERKMKPKASLPPKYALELLTVYAWEQGSGTDDFDIAEGFRTVLDLVIKYRQLCIFWTVNYNFEEEYMRKFLLTQIQKKRPVILDPADPTGDVGGGDRWCWHLLAEEAKEWLSSPCFQVEQKGLVQPWKVPVMQTPGSCGGQIYPTVGGVTK", "length": 742, "header": "sp|E9Q9A9-1|OAS2_MOUSE Isoform 1 of 2'-5'-oligoadenylate synthase 2 OS=Mus musculus OX=10090 GN=Oas2 PE=1 SV=1 CANONICAL=E9Q9A9-1" }, "locus": { "chromosome": "5", "start_pos": 120887838, "end_pos": 120869961, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000053909", "url": "https://www.ensembl.org/id/ENSMUST00000053909" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000060082", "url": "https://www.ensembl.org/id/ENSMUSP00000060082" } ] } }, { "isoform_ac": "E9Q9A9-2", "url": "", "sequence": { "sequence": "MGNWLTGNWSSDRSSGYSSGWSPGGSSGVPSGPVHKLEKSIQANLTPNENCLKQIAVSSVPSQKLEGYIQENLKPNRESLKQIDQAVDAIWDLLRSQIPVKEVAKGGSYGRETALRGCSDGTLVLFMDCFQQFQDQIKYQDAYLDVIELWLKIHEKKSVKHEHALVVQVSVPGQRILLQLLPVFNPLRSNENPSSCVYVDLKKSMDQVRASPGEFSDCFTTLQQRFFKKYPQRLKDLILLVKHWYEQCQEKWKTPPPQPLLYALELLTVYAWEQGCQAEDFDMAQGVRTVLRLIQRPTELCVYWTVNYNFEDETVRNILLHQLRSQRPVILDPTDPTNNVGKDDGFWELLTEEAMAWLYSPSLNTESPAPYWDVLPMPLFVTPSHLLNKFIKDFLQPNKLFLKQIKEAVDIICSFLKNVCFLNSDTKVLKTVKGGSTAKGTALKRGSDADIVVFLSSLESYDSLKTNRSQFVQEIQKQLEEFVQAQEWEVTFEISKWKAPRVLSFTLKSKTLNESVEFDVLPAYDALGQLRSDFTLRPEAYKDLIELCASQDIKEGEFSICFTELQRNFIQTRPTKLKSLLRLIKHWYKQYERKMKPKASLPPKYALELLTVYAWEQGSGTDDFDIAEGFRTVLDLVIKYRQLCIFWTVNYNFEEEYMRKFLLTQIQKKRPVILDPADPTGDVGGGDRWCWHLLAEEAKEWLSSPCFQVEQKGLVQPWKVPVPRDLKTSDMVGVFTTGGILWQDQGFLSFV", "length": 751, "header": "sp|E9Q9A9-2|OAS2_MOUSE Isoform 2 of 2'-5'-oligoadenylate synthase 2 OS=Mus musculus OX=10090 GN=Oas2 PE=1 SV=1 CANONICAL=E9Q9A9-1" }, "locus": { "chromosome": "5", "start_pos": 120887838, "end_pos": 120871205, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000081491", "url": "https://www.ensembl.org/id/ENSMUST00000081491" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000080209", "url": "https://www.ensembl.org/id/ENSMUSP00000080209" } ] } }, { "isoform_ac": "F7CFL3-1", "url": "", "sequence": { "sequence": "XTFEISKWKAPRVLSFTLKSKTLNESVEFDVLPAYDALGQLRSDFTLRPEAYKDLIELCASQDIKEGEFSICFTELQRNFIQTRPTKLKSLLRLIKHWYKQYERKMKPKASLPPKYALELLTVYAWEQGSGTDDFDIAEGFRTVLDLVIKYRQLCIFWTVNYNFEEEYMRKFLLTQIQKKRPVILDPADPTGDVGGGDRWCWHLLAEEAKEWLSSPCFQVEQKGLVQPWKVPVRAL", "length": 236, "header": "tr|F7CFL3-1|F7CFL3_MOUSE Computationally mapped isoform of 2'-5' oligoadenylate synthetase 2 OS=Mus musculus OX=10090 GN=Oas2 PE=1 SV=1 CANONICAL=E9Q9A9-1" }, "locus": { "chromosome": "5", "start_pos": 120876473, "end_pos": 120871466, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000146101.2", "url": "https://www.ensembl.org/id/ENSMUST00000146101.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000122053.2", "url": "https://www.ensembl.org/id/ENSMUSP00000122053.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Positional cloning of the murine flavivirus resistance gene.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2002", "authors": "Perelygin AA, Scherbik SV, Zhulin IB, Stockman BM, Li Y, Brinton MA", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "reference": [ { "type": "PubMed", "id": "12080145", "url": "https://glygen.org/publication/PubMed/12080145" } ] }, { "title": "Genomic structure of the mouse 2',5'-oligoadenylate synthetase gene family.", "journal": "J. Interferon Cytokine Res.", "date": "2002", "authors": "Kakuta S, Shibata S, Iwakura Y", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "reference": [ { "type": "PubMed", "id": "12396720", "url": "https://glygen.org/publication/PubMed/12396720" } ] }, { "title": "Natural mutations in a 2'-5' oligoadenylate synthetase transgene revealed residues essential for enzyme activity.", "journal": "Biochemistry", "date": "2005", "authors": "Sarkar SN, Kessler SP, Rowe TM, Pandey M, Ghosh A, Elco CP, Hartmann R, Pal S, Sen GC", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "reference": [ { "type": "PubMed", "id": "15865429", "url": "https://glygen.org/publication/PubMed/15865429" } ] }, { "title": "The mammalian 2'-5' oligoadenylate synthetase gene family: evidence for concerted evolution of paralogous Oas1 genes in Rodentia and Artiodactyla.", "journal": "J. Mol. Evol.", "date": "2006", "authors": "Perelygin AA, Zharkikh AA, Scherbik SV, Brinton MA", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "reference": [ { "type": "PubMed", "id": "17024523", "url": "https://glygen.org/publication/PubMed/17024523" } ] }, { "title": "The oligoadenylate synthetase family: an ancient protein family with multiple antiviral activities.", "journal": "J. Interferon Cytokine Res.", "date": "2011", "authors": "Kristiansen H, Gad HH, Eskildsen-Larsen S, Despres P, Hartmann R", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "reference": [ { "type": "PubMed", "id": "21142819", "url": "https://glygen.org/publication/PubMed/21142819" } ] }, { "title": "A mutation in the viral sensor 2'-5'-oligoadenylate synthetase 2 causes failure of lactation.", "journal": "PLoS Genet.", "date": "2017", "authors": "Oakes SR, Gallego-Ortega D, Stanford PM, Junankar S, Au WWY, Kikhtyak Z, von Korff A, Sergio CM, Law AMK, Castillo LE, Allerdice SL, Young AIJ, Piggin C, Whittle B, Bertram E, Naylor MJ, Roden DL, Donovan J, Korennykh A, Goodnow CC, O'Bryan MK, Ormandy CJ", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" }, { "database": "RefSeq", "id": "NP_001334377", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001334377" } ], "reference": [ { "type": "PubMed", "id": "29117179", "url": "https://glygen.org/publication/PubMed/29117179" } ] } ], "pathway": [ { "id": "mmu:246728", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:246728", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGNGESQLSSVPAQKLGWFIQEYLKPYEECQTLIDEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDLKQFQDQKRSQRDILDKTGDKLKFCLFTKWLKNNFEIQKSLDGFTIQVFTKNQRISFEVLAAFNALSLNDNPSPWIYRELKRSLDKTNASPGEFAVCFTELQQKFFDNRPGKLKDLILLIKHWHQQCQKKIKDLPSLSPYALELLTVYAWEQGCRKDNFDIAEGVRTVLELIKCQEKLCIYWMVNYNFEDETIRNILLHQLQSARPVILDPVDPTNNVSGDKICWQWLKKEAQTWLTSPNLDNELPAPSWNVLPAPLFTTPGHLLDKFIKEFLQPNKCFLEQIDSAVNIIRTFLKENCFRQSTAKIQIVRGGSTAKGTALKTGSDADLVVFHNSLKSYTSQKNERHKIVKEIHEQLKAFWREKEEELEVSFEPPKWKAPRVLSFSLKSKVLNESVSFDVLPAFNALGQLSSGSTPSPEVYAGLIDLYKSSDLPGGEFSTCFTVLQRNFIRSRPTKLKDLIRLVKHWYKECERKLKPKGSLPPKYALELLTIYAWEQGSGVPDFDTAEGFRTVLELVTQYQQLCIFWKVNYNFEDETVRKFLLSQLQKTRPVILDPAEPTGDVGGGDRWCWHLLAKEAKEWLSSPCFKDGTGNPIPPWKVPTMQTPGSCGARIHPIVNEMFSSRSHRILNNNSKRNF", "length": 719 }, "evidence": [ { "id": "45242623", "url": "http://www.informatics.jax.org/homology/45242623", "database": "MGI" }, { "id": "E9Q9A9", "url": "https://omabrowser.org/oma/group/E9Q9A9/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q5MYU0-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "Oas2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGNWMPGWSSSGSLGVPPMPVQKLEKSVQVNLEPDEKCLSQTEVSSVPSQKLEEYIQANLKPDEESLKQIDQAVDAISDLLCSEVMIDVLKVVKGGSYGRKTVLRDCSDGTLVLFTGLFKQFQDQKKYQDKLLDLIEQRLKSHEKYKKSVKRKLSLLEVQVSIPGQSILLQLLPTFNPLCISENPSAQVYQNLKRSMDQVKASPGEFSDCFTTLQQRFFEKYPGRLKDLILLVKHWYKQLQDKWIIPSPPPLLYALELLTVYAWEQGCQTKDFDITQGIRTVLQLISQPTNLCVYWLDNYNFEDETVRNNLLHQLNSPRPVILDPTDPTNNVGKDDRFWQLLAEEAQEWLNSLRLNKPHKPCWDVLPMPFFITPSHCLDKFIKDFLQPDKVFLNQIKRAVDIICSFLKETCFQNSDIKVLKIIKGGSTAKGTALQQRSDADIIVFLSSLDSYDSLETERSQYVQEIRKQLEACQKAFNLGVKFDISKWMAPRVLSFTLESKSLKQSVEFDVLPAYDALGQLRSDYTSRLKAYKKLIELYASQDSLKGGEFSVCFTELQRDFIETRPTKLKGLIRLIKHWYKQCERKMKPKASLPPKYALELLTVYAWEHGSGTDGFDTAEGFRTVLDLVIRYRQLCVFWTVNYNFEEDHMRKFLLTQIQKKRPVILDPADPTGDVGGGDRWCWHLLAKEAKEWLSSSCFQVEPKSPVQPWKVPVVQTPGSCGAQIYPVVGGVY", "length": 733 }, "evidence": [ { "id": "45242623", "url": "http://www.informatics.jax.org/homology/45242623", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 13, "go_terms": [ { "name": "interleukin-27-mediated signaling pathway", "id": "GO:0070106", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070106", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" }, { "name": "defense response to virus", "id": "GO:0051607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051607", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" }, { "name": "negative regulation of viral genome replication", "id": "GO:0045071", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045071", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" }, { "name": "response to bacterium", "id": "GO:0009617", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009617", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" }, { "name": "type I interferon-mediated signaling pathway", "id": "GO:0060337", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060337", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" }, { "name": "response to virus", "id": "GO:0009615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009615", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" }, { "name": "positive regulation of tumor necrosis factor production", "id": "GO:0032760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032760", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" }, { "name": "defense response to bacterium", "id": "GO:0042742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042742", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" }, { "name": "positive regulation of interferon-beta production", "id": "GO:0032728", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032728", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" }, { "name": "regulation of ribonuclease activity", "id": "GO:0060700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060700", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" }, { "name": "RNA catabolic process", "id": "GO:0006401", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006401", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" }, { "name": "regulation of lactation", "id": "GO:1903487", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903487", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" }, { "name": "double-stranded RNA binding", "id": "GO:0003725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003725", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" }, { "name": "2'-5'-oligoadenylate synthetase activity", "id": "GO:0001730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001730", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 44, "end_pos": 46, "annotation": "n_glycosylation_sequon" }, { "start_pos": 467, "end_pos": 469, "annotation": "n_glycosylation_sequon" }, { "start_pos": 513, "end_pos": 515, "annotation": "n_glycosylation_sequon" }, { "start_pos": 8, "end_pos": 10, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Glycosylated. Glycosylation is essential for its activity.", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" }, { "database": "PubMed", "id": "P29728", "url": "https://glygen.org/publication/PubMed/P29728" } ] }, { "annotation": "Myristoylation is not essential for its activity.", "evidence": [ { "database": "UniProtKB", "id": "E9Q9A9", "url": "https://www.uniprot.org/uniprot/E9Q9A9" }, { "database": "PubMed", "id": "P29728", "url": "https://glygen.org/publication/PubMed/P29728" } ] } ], "interactions": [], "reactions": [ { "id": "34407", "name": "", "equation": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5MYT7-1", "Q5MYT9-1", "Q05961-1", "Q5MYU0-1", "Q5BKD0-1", "Q5MYX1-1", "P00973-1", "P29728-1", "Q9Y6K5-1", "Q8VI93-1", "E9Q9A9-1", "Q9Z2F2-1", "P11928-1", "Q8K469-1" ], "evidence": [ { "id": "34407", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/34407" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "E9Q9A9", "gene_name": "Oas2", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "E9Q9A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "E9Q9A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q9A9" } ] } ] }, { "uniprot_ac": "P00973", "gene_name": "OAS1", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "P00973", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00973" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "P00973", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00973" } ] } ] }, { "uniprot_ac": "P11928", "gene_name": "Oas1a", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "P11928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11928" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "P11928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11928" } ] } ] }, { "uniprot_ac": "P29728", "gene_name": "OAS2", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "P29728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29728" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "P29728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29728" } ] } ] }, { "uniprot_ac": "Q05961", "gene_name": "Oas1a", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q05961", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05961" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q05961", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05961" } ] } ] }, { "uniprot_ac": "Q5BKD0", "gene_name": "Oas1b", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q5BKD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BKD0" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q5BKD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BKD0" } ] } ] }, { "uniprot_ac": "Q5MYT7", "gene_name": "Oas3", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q5MYT7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MYT7" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q5MYT7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MYT7" } ] } ] }, { "uniprot_ac": "Q5MYT9", "gene_name": "Oasl2", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q5MYT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MYT9" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q5MYT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MYT9" } ] } ] }, { "uniprot_ac": "Q5MYU0", "gene_name": "Oas2", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q5MYU0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MYU0" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q5MYU0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MYU0" } ] } ] }, { "uniprot_ac": "Q5MYX1", "gene_name": "Oas1i", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q5MYX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MYX1" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q5MYX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5MYX1" } ] } ] }, { "uniprot_ac": "Q8K469", "gene_name": "Oas1g", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q8K469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K469" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q8K469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K469" } ] } ] }, { "uniprot_ac": "Q8VI93", "gene_name": "Oas3", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q8VI93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VI93" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q8VI93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VI93" } ] } ] }, { "uniprot_ac": "Q9Y6K5", "gene_name": "OAS3", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q9Y6K5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K5" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q9Y6K5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K5" } ] } ] }, { "uniprot_ac": "Q9Z2F2", "gene_name": "Oasl2", "activity": [ { "ec_number": "2.7.7.84", "activity": "3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate.", "evidence": [ { "id": "Q9Z2F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2F2" } ] }, { "ec_number": "2.7.7.84", "activity": "", "evidence": [ { "id": "Q9Z2F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2F2" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }