{ "uniprot_canonical_ac": "D4ADY9-1", "uniprot_ac": "D4ADY9", "uniprot_id": "ELOV7_RAT", "mass": { "chemical_mass": 33547.0, "monoisotopic_mass": 33547.0 }, "refseq": { "ac": "NP_001178773", "name": "elongation of very long chain fatty acids protein 7", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178773" }, "gene_names": [ { "name": "Elovl7", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D4ADY9", "id": "D4ADY9" }, { "name": "Elovl7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178773", "id": "NP_001178773" } ], "protein_names": [ { "name": "Elongation of very long chain fatty acids protein 7", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "D4ADY9" }, { "name": "2.3.1.199", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D4ADY9" }, { "name": "3-keto acyl-CoA synthase Elovl7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D4ADY9" }, { "name": "ELOVL FA elongase 7; 3-keto acyl-CoA synthase Elovl7; very long chain 3-oxoacyl-CoA synthase 7; very long chain 3-ketoacyl-CoA synthase 7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178773", "id": "NP_001178773" }, { "name": "ELOVL FA elongase 7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D4ADY9" }, { "name": "ELOVL fatty acid elongase 7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D4ADY9" }, { "name": "Very long chain 3-ketoacyl-CoA synthase 7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D4ADY9" }, { "name": "Very long chain 3-oxoacyl-CoA synthase 7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D4ADY9" }, { "name": "elongation of very long chain fatty acids protein 7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178773", "id": "NP_001178773" } ], "function": [ { "annotation": "Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme with higher activity toward C18 acyl-CoAs, especially C18:3(n-3) acyl-CoAs and C18:3(n-6)-CoAs. Also active toward C20:4-, C18:0-, C18:1-, C18:2- and C16:0-CoAs, and weakly toward C20:0-CoA. Little or no activity toward C22:0-, C24:0-, or C26:0-CoAs. May participate in the production of saturated and polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.", "evidence": [ { "database": "UniProtKB", "id": "D4ADY9", "url": "https://www.uniprot.org/uniprot/D4ADY9#function" }, { "database": "UniProtKB", "id": "MF_03207", "url": "https://www.uniprot.org/uniprot/MF_03207#function" } ] } ], "disease": [ { "disease_id": "DOID:10588", "recommended_name": { "id": "DOID:10588", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10588", "name": "adrenoleukodystrophy", "description": "A leukodystrophy that disrupts the breakdown of very-long-chain fatty acids resulting in progressive brain damage, failure of the adrenal glands and eventually death." }, "synonyms": [ { "id": "DOID:10588", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10588", "name": "ALD", "description": "" }, { "id": "DOID:10588", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10588", "name": "Bronze Schilder disease", "description": "" }, { "id": "DOID:10588", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10588", "name": "Encephalitis periaxialis concentrica", "description": "" }, { "id": "DOID:10588", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10588", "name": "Encephalitis periaxialis, Schilder's", "description": "" }, { "id": "DOID:10588", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10588", "name": "Siemerling-Creutzfeldt Disease", "description": "" }, { "id": "DOID:10588", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10588", "name": "X-linked adrenoleukodystrophy", "description": "" }, { "id": "DOID:10588", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10588", "name": "diffuse sclerosis", "description": "" }, { "id": "DOID:10588", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10588", "name": "sudanophilic cerebral sclerosis", "description": "" }, { "id": "MONDO:0018544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018544", "name": "adrenoleukodystrophy", "description": "A peroxisomal disorder resulting in cerebral demyelination, axonal dysfunction in the spinal cord leading to spastic paraplegia, adrenal insufficiency and in some cases testicular insufficiency." }, { "id": "MONDO:0018544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018544", "name": "ABCD1 deficiency", "description": "" }, { "id": "MONDO:0018544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018544", "name": "ALD", "description": "" }, { "id": "MONDO:0018544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018544", "name": "Bronze-Schilder disease", "description": "" }, { "id": "MONDO:0018544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018544", "name": "Siemerling-Creutzfeldt disease", "description": "" }, { "id": "MONDO:0018544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018544", "name": "X-ALD", "description": "" }, { "id": "MONDO:0018544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018544", "name": "X-linked ALD", "description": "" }, { "id": "MONDO:0018544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018544", "name": "X-linked adrenoleukodystrophy", "description": "" }, { "id": "MONDO:0018544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018544", "name": "adrenoleukodystrophy", "description": "" }, { "id": "MONDO:0018544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018544", "name": "adrenoleukodystrophy, X-linked", "description": "" }, { "id": "MONDO:0018544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018544", "name": "adrenoleukodystrophy, X-linked recessive", "description": "" }, { "id": "MONDO:0018544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018544", "name": "adrenomyeloneuropathy, adult", "description": "" }, { "id": "MONDO:0018544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018544", "name": "adrenomyeloneuropathy, adult, X-linked recessive", "description": "" }, { "id": "MONDO:0018544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018544", "name": "diffuse cerebral sclerosis of Schilder", "description": "" }, { "id": "MONDO:0018544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018544", "name": "encephalitis periaxialis concentrica", "description": "" }, { "id": "MONDO:0018544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018544", "name": "encephalitis periaxialis, Schilder's", "description": "" }, { "id": "MONDO:0018544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018544", "name": "sudanophilic cerebral sclerosis", "description": "" }, { "id": "MONDO:0018544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018544", "name": "diffuse sclerosis", "description": "" }, { "id": "MIM:300100", "resource": "MIM", "url": "https://www.omim.org/entry/300100", "name": "Adrenoleukodystrophy", "description": "Adrenoleukodystrophy" } ], "evidence": [ { "id": "10588", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10588" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D4ADY9", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ], "common_name": "Rat" } ], "gene": [ { "name": "Elovl7", "url": "https://www.uniprot.org/uniprot/D4ADY9", "locus": { "chromosome": "2", "start_pos": 39856845, "end_pos": 39789250, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000010450", "url": "https://www.ensembl.org/id/ENSRNOG00000010450" } ] } } ], "crossref": [ { "id": "ENSRNOG00000010450", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000010450", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "361895", "url": "https://www.ncbi.nlm.nih.gov/gene/361895", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002076", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002076", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030457", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030457", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033670", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033670", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:361895", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:361895", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "LPTLGMC", "url": "https://omabrowser.org/oma/group/LPTLGMC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "168669at2759", "url": "http://www.orthodb.org/?query=168669at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11157", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11157", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11157:SF118", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11157:SF118", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01151", "url": "http://pfam.xfam.org/family/PF01151", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_D4ADY9", "url": "http://purl.obolibrary.org/obo/PR_D4ADY9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-75876", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001178773", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178773", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1310560", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1310560", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "32727", "url": "https://www.rhea-db.org/rhea/32727", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "35315", "url": "https://www.rhea-db.org/rhea/35315", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "35319", "url": "https://www.rhea-db.org/rhea/35319", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "35327", "url": "https://www.rhea-db.org/rhea/35327", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "35379", "url": "https://www.rhea-db.org/rhea/35379", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "36475", "url": "https://www.rhea-db.org/rhea/36475", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "36503", "url": "https://www.rhea-db.org/rhea/36503", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "36511", "url": "https://www.rhea-db.org/rhea/36511", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "36523", "url": "https://www.rhea-db.org/rhea/36523", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0A0MXW4", "url": "https://www.uniprot.org/uniprot/A0A0A0MXW4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0A0MXW4-1", "url": "https://www.uniprot.org/uniprot/A0A0A0MXW4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A659", "url": "https://www.uniprot.org/uniprot/A0A8I6A659", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A659-1", "url": "https://www.uniprot.org/uniprot/A0A8I6A659-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4ADY9", "url": "https://www.uniprot.org/uniprot/D4ADY9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4ADY9-1", "url": "https://www.uniprot.org/uniprot/D4ADY9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAFSDLTSRTVRFYDNWIKDADPRVENWLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGTGYSFRCDIVDYSQSPRAMRMVHTCWLYYFSKFIELFDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYFYYGLCAMGPAYQKYLWWKKHLTSLQLVQFVLVTVHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAYTKGQRLPKTMENGNCKSKHH", "length": 281, "header": "sp|D4ADY9-1|ELOV7_RAT Isoform 1 of Elongation of very long chain fatty acids protein 7 OS=Rattus norvegicus OX=10116 GN=Elovl7 PE=3 SV=1 CANONICAL=D4ADY9-1" }, "isoforms": [ { "isoform_ac": "A0A0A0MXW4-1", "url": "", "sequence": { "sequence": "LFSVFLFQFVMSGWGTGYSFRCDIVDYSQSPRAMRMVHTCWLYYFSKFIELFDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYFYYGLCAMGPAYQKYLWWKKHLTSLQLVQFVLVTVHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAYTKGQRLPKTMENGNCKSKHH", "length": 204, "header": "tr|A0A0A0MXW4-1|A0A0A0MXW4_RAT Computationally mapped isoform of Elongation of very long chain fatty acids protein OS=Rattus norvegicus OX=10116 GN=Elovl7 PE=3 SV=1 CANONICAL=D4ADY9-1" }, "locus": { "chromosome": "2", "start_pos": 39856560, "end_pos": 39829414, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000014074", "url": "https://www.ensembl.org/id/ENSRNOT00000014074" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000014074", "url": "https://www.ensembl.org/id/ENSRNOP00000014074" } ] } }, { "isoform_ac": "A0A8I6A659-1", "url": "", "sequence": { "sequence": "MAFSDLTSRTVRFYDNWIKDADPRVENWLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGTGYSFRCDIVDYSQSPRAMRIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYFYYGLCAMGPAYQKYLWWKKHLTSLQLVQFVLVTVHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAYTKGQRLPKTMENGNCKSKHH", "length": 262, "header": "tr|A0A8I6A659-1|A0A8I6A659_RAT Computationally mapped isoform of Elongation of very long chain fatty acids protein OS=Rattus norvegicus OX=10116 GN=Elovl7 PE=3 SV=1 CANONICAL=D4ADY9-1" }, "locus": { "chromosome": "2", "start_pos": 39856560, "end_pos": 39829414, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000095957.1", "url": "https://www.ensembl.org/id/ENSRNOT00000095957.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000086615.1", "url": "https://www.ensembl.org/id/ENSRNOP00000086615.1" } ] } }, { "isoform_ac": "D4ADY9-1", "url": "", "sequence": { "sequence": "MAFSDLTSRTVRFYDNWIKDADPRVENWLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGTGYSFRCDIVDYSQSPRAMRMVHTCWLYYFSKFIELFDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYFYYGLCAMGPAYQKYLWWKKHLTSLQLVQFVLVTVHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAYTKGQRLPKTMENGNCKSKHH", "length": 281, "header": "sp|D4ADY9-1|ELOV7_RAT Isoform 1 of Elongation of very long chain fatty acids protein 7 OS=Rattus norvegicus OX=10116 GN=Elovl7 PE=3 SV=1 CANONICAL=D4ADY9-1" }, "locus": { "chromosome": "2", "start_pos": 39856560, "end_pos": 39829414, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000014074", "url": "https://www.ensembl.org/id/ENSRNOT00000014074" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000014074", "url": "https://www.ensembl.org/id/ENSRNOP00000014074" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "rno:361895", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:361895", "resource": "KEGG Pathway" }, { "id": "R-RNO-75876", "name": "Synthesis of very long-chain fatty acyl-CoAs", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-75876", "resource": "Reactome", "description": "Synthesis of very long-chain fatty acyl-CoAs" } ], "orthologs": [ { "uniprot_canonical_ac": "A1L3X0-1", "protein_name": "Elongation of very long chain fatty acids protein 7", "gene_name": "ELOVL7", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKYLWWKKYLTSLQLVQFVIVAIHISQFFFMEDCKYQFPVFACIIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKNKDN", "length": 281 }, "evidence": [ { "id": "45237231", "url": "http://www.informatics.jax.org/homology/45237231", "database": "MGI" }, { "id": "D4ADY9", "url": "https://omabrowser.org/oma/group/D4ADY9/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9D2Y9-1", "protein_name": "Elongation of very long chain fatty acids protein 7", "gene_name": "Elovl7", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAFSDLTSRTVRFYDNWIKDADPRVEDYLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGTGYSFRCDIVDYSQSPRAMRMVHTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHAFLNTAVHVVMYSYYGLCAMGPAYQKYLWWKKHLTSLQLVQFVLVTIHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAYTKGQRLPKTLENGNCKSKRH", "length": 281 }, "evidence": [ { "id": "45237231", "url": "http://www.informatics.jax.org/homology/45237231", "database": "MGI" }, { "id": "D4ADY9", "url": "https://omabrowser.org/oma/group/D4ADY9/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "D4ADY9", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "D4ADY9", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "D4ADY9", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "fatty acid elongation, polyunsaturated fatty acid", "id": "GO:0034626", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034626", "evidence": [ { "database": "UniProtKB", "id": "D4ADY9", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ], "pmid": "" }, { "name": "fatty acid elongation, saturated fatty acid", "id": "GO:0019367", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019367", "evidence": [ { "database": "UniProtKB", "id": "D4ADY9", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ], "pmid": "" }, { "name": "very long-chain fatty acid biosynthetic process", "id": "GO:0042761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042761", "evidence": [ { "database": "UniProtKB", "id": "D4ADY9", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ], "pmid": "" }, { "name": "fatty acid biosynthetic process", "id": "GO:0006633", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006633", "evidence": [ { "database": "UniProtKB", "id": "D4ADY9", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ], "pmid": "" }, { "name": "sphingolipid biosynthetic process", "id": "GO:0030148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030148", "evidence": [ { "database": "UniProtKB", "id": "D4ADY9", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ], "pmid": "" }, { "name": "long-chain fatty-acyl-CoA biosynthetic process", "id": "GO:0035338", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035338", "evidence": [ { "database": "UniProtKB", "id": "D4ADY9", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ], "pmid": "" }, { "name": "unsaturated fatty acid biosynthetic process", "id": "GO:0006636", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006636", "evidence": [ { "database": "UniProtKB", "id": "D4ADY9", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ], "pmid": "" }, { "name": "fatty acid elongation, monounsaturated fatty acid", "id": "GO:0034625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034625", "evidence": [ { "database": "UniProtKB", "id": "D4ADY9", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "fatty acid elongase activity", "id": "GO:0009922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009922", "evidence": [ { "database": "UniProtKB", "id": "D4ADY9", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ], "pmid": "" }, { "name": "very-long-chain 3-ketoacyl-CoA synthase activity", "id": "GO:0102756", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102756", "evidence": [ { "database": "UniProtKB", "id": "D4ADY9", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "32727", "name": "", "equation": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4A612-1", "D4ADY9-1", "Q920L7-1", "Q920L6-1", "A0A1B0GWP1-1", "D3ZPX9-1", "D4ACH5-1", "A1L3X0-1", "Q9H5J4-1", "Q9GZR5-1", "Q9NYP7-1", "Q9HB03-1", "Q9NXB9-1", "Q9BW60-1", "Q920L5-1", "Q8BHI7-1", "O35949-1", "Q9EQC4-1", "Q9D2Y9-1", "Q9JLJ4-1", "Q9JLJ5-1", "P25358-1", "P39540-1", "P40319-1", "Q55BY4-1", "C7FZW5-1", "Q54TC9-1", "Q555E8-1", "Q86JM5-1", "Q7KWQ5-1", "Q54CJ4-1", "A8JNR0-1", "Q9VHX7-1", "A0A0B4KF65-1", "Q9VH58-1", "Q9VV87-1", "Q6NN18-1", "Q4V3H4-1", "A1ZBD2-1", "Q9VCY6-1", "Q5JZZ4-1", "Q9VH59-1", "Q9VCT3-1", "Q95T98-1", "Q9VCY5-1", "Q9VH57-1", "Q8SXD1-1", "Q8IMY2-1", "Q9VCY7-1", "Q9VCZ0-1", "Q9VH55-1" ], "evidence": [ { "id": "32727", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/32727" } ] }, { "id": "35315", "name": "", "equation": "H(+) + hexadecanoyl-CoA + malonyl-CoA = 3-oxooctadecanoyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4ADY9-1", "Q920L6-1", "A1L3X0-1", "Q9H5J4-1", "Q9HB03-1", "Q920L5-1", "O35949-1", "Q9D2Y9-1", "P25358-1", "P40319-1", "Q9VV87-1" ], "evidence": [ { "id": "35315", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/35315" } ] }, { "id": "35319", "name": "", "equation": "H(+) + malonyl-CoA + octadecanoyl-CoA = 3-oxoeicosanoyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4ADY9-1", "A1L3X0-1", "Q9HB03-1", "Q9BW60-1", "O35949-1", "Q9D2Y9-1", "P25358-1", "P40319-1" ], "evidence": [ { "id": "35319", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/35319" } ] }, { "id": "35327", "name": "", "equation": "eicosanoyl-CoA + H(+) + malonyl-CoA = 3-oxodocosanoyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4ADY9-1", "A1L3X0-1", "Q9HB03-1", "Q9BW60-1", "O35949-1", "Q9D2Y9-1", "Q9JLJ5-1", "P25358-1", "P40319-1" ], "evidence": [ { "id": "35327", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/35327" } ] }, { "id": "35379", "name": "", "equation": "(6Z,9Z,12Z)-octadecatrienoyl-CoA + H(+) + malonyl-CoA = (8Z,11Z,14Z)-3-oxoeicosatrienoyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4ADY9-1", "Q920L7-1", "A1L3X0-1", "Q9NYP7-1", "Q8BHI7-1", "Q9D2Y9-1" ], "evidence": [ { "id": "35379", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/35379" } ] }, { "id": "36475", "name": "", "equation": "(5Z,8Z,11Z,14Z)-eicosatetraenoyl-CoA + H(+) + malonyl-CoA = (7Z,10Z,13Z,16Z)-3-oxodocosatetraenoyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4A612-1", "D4ADY9-1", "Q920L7-1", "A1L3X0-1", "Q9NYP7-1", "Q9NXB9-1", "Q8BHI7-1", "Q9D2Y9-1", "Q9JLJ4-1" ], "evidence": [ { "id": "36475", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/36475" } ] }, { "id": "36503", "name": "", "equation": "(9Z,12Z)-octadecadienoyl-CoA + H(+) + malonyl-CoA = (11Z,14Z)-3-oxoicosa-11,14-dienoyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4ADY9-1", "Q920L7-1", "Q920L6-1", "A1L3X0-1", "Q9NYP7-1", "Q9H5J4-1", "Q9HB03-1", "Q920L5-1", "O35949-1", "Q8BHI7-1", "Q9D2Y9-1" ], "evidence": [ { "id": "36503", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/36503" } ] }, { "id": "36511", "name": "", "equation": "(9Z)-octadecenoyl-CoA + H(+) + malonyl-CoA = (11Z)-3-oxoicosenoyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4ADY9-1", "Q920L7-1", "Q920L6-1", "A1L3X0-1", "Q9NYP7-1", "Q9H5J4-1", "Q9HB03-1", "Q920L5-1", "O35949-1", "Q8BHI7-1", "Q9D2Y9-1" ], "evidence": [ { "id": "36511", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/36511" } ] }, { "id": "36523", "name": "", "equation": "(9Z,12Z,15Z)-octadecatrienoyl-CoA + H(+) + malonyl-CoA = (11Z,14Z,17Z)-3-oxoeicosatrienoyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4ADY9-1", "Q920L7-1", "Q920L6-1", "A1L3X0-1", "Q9NYP7-1", "Q9H5J4-1", "Q9HB03-1", "Q920L5-1", "O35949-1", "Q8BHI7-1", "Q9D2Y9-1" ], "evidence": [ { "id": "36523", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/36523" } ] }, { "id": "R-RNO-548814", "name": "ELOVL3,6,7 elongate PALM-CoA and Mal-CoA to 3OOD-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-548812" ], "enzyme_list": [ "D4ADY9-1", "Q920L6-1", "D3ZPX9-1" ], "evidence": [ { "id": "R-RNO-548814", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-548814" } ] }, { "id": "R-RNO-548815", "name": "ELOVL7 elongates ICS-CoA and Mal-CoA to 3ODC-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-548794" ], "output_participant_list": [ "R-ALL-548829" ], "enzyme_list": [ "D4ADY9-1" ], "evidence": [ { "id": "R-RNO-548815", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-548815" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-548794", "participant_name": "ICS-CoA [cytosol]", "crossref": [ { "id": "57380", "database": "ChEBI", "url": "" }, { "id": "57380", "database": "ChEBI", "url": "" }, { "id": "57380", "database": "ChEBI", "url": "" }, { "id": "57380", "database": "ChEBI", "url": "" }, { "id": "57380", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-548812", "participant_name": "3OOD-CoA [cytosol]", "crossref": [ { "id": "71407", "database": "ChEBI", "url": "" }, { "id": "71407", "database": "ChEBI", "url": "" }, { "id": "71407", "database": "ChEBI", "url": "" }, { "id": "71407", "database": "ChEBI", "url": "" }, { "id": "71407", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-548829", "participant_name": "3ODC-CoA [cytosol]", "crossref": [ { "id": "71451", "database": "ChEBI", "url": "" }, { "id": "71451", "database": "ChEBI", "url": "" }, { "id": "71451", "database": "ChEBI", "url": "" }, { "id": "71451", "database": "ChEBI", "url": "" }, { "id": "71451", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0B4KF65", "gene_name": "BcDNA:GH22993", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A0A0B4KF65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A0A0B4KF65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ] } ] }, { "uniprot_ac": "A0A1B0GWP1", "gene_name": "Elovl1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A0A1B0GWP1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1B0GWP1" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A0A1B0GWP1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1B0GWP1" } ] } ] }, { "uniprot_ac": "A1L3X0", "gene_name": "ELOVL7", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A1L3X0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A1L3X0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ] } ] }, { "uniprot_ac": "A1ZBD2", "gene_name": "Dmel\\CG17821", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A1ZBD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBD2" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A1ZBD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBD2" } ] } ] }, { "uniprot_ac": "A8JNR0", "gene_name": "Elo68beta", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A8JNR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A8JNR0" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A8JNR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A8JNR0" } ] } ] }, { "uniprot_ac": "C7FZW5", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "C7FZW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C7FZW5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "C7FZW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C7FZW5" } ] } ] }, { "uniprot_ac": "D3ZPX9", "gene_name": "Elovl3", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "D3ZPX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZPX9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "D3ZPX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZPX9" } ] } ] }, { "uniprot_ac": "D4A612", "gene_name": "Elovl2", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "D4A612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A612" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "D4A612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A612" } ] } ] }, { "uniprot_ac": "D4ACH5", "gene_name": "Elovl4", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "D4ACH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ACH5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "D4ACH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ACH5" } ] } ] }, { "uniprot_ac": "D4ADY9", "gene_name": "Elovl7", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "D4ADY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "D4ADY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ] } ] }, { "uniprot_ac": "O35949", "gene_name": "Elovl3", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "O35949", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35949" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "O35949", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35949" } ] } ] }, { "uniprot_ac": "P25358", "gene_name": "ELO2", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "P25358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25358" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "P25358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25358" } ] } ] }, { "uniprot_ac": "P39540", "gene_name": "ELO1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "P39540", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39540" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "P39540", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39540" } ] } ] }, { "uniprot_ac": "P40319", "gene_name": "ELO3", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "P40319", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40319" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "P40319", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40319" } ] } ] }, { "uniprot_ac": "Q4V3H4", "gene_name": "Dmel\\CG9459", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q4V3H4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V3H4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q4V3H4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V3H4" } ] } ] }, { "uniprot_ac": "Q54CJ4", "gene_name": "eloA", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q54CJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54CJ4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q54CJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54CJ4" } ] } ] }, { "uniprot_ac": "Q54TC9", "gene_name": "sre1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q54TC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TC9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q54TC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TC9" } ] } ] }, { "uniprot_ac": "Q555E8", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q555E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q555E8" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q555E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q555E8" } ] } ] }, { "uniprot_ac": "Q55BY4", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q55BY4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55BY4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q55BY4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55BY4" } ] } ] }, { "uniprot_ac": "Q5JZZ4", "gene_name": "Elo68alpha", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q5JZZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JZZ4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q5JZZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JZZ4" } ] } ] }, { "uniprot_ac": "Q6NN18", "gene_name": "CT42569", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q6NN18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NN18" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q6NN18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NN18" } ] } ] }, { "uniprot_ac": "Q7KWQ5", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q7KWQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KWQ5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q7KWQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KWQ5" } ] } ] }, { "uniprot_ac": "Q86JM5", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q86JM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86JM5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q86JM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86JM5" } ] } ] }, { "uniprot_ac": "Q8BHI7", "gene_name": "Elovl5", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q8BHI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BHI7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q8BHI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BHI7" } ] } ] }, { "uniprot_ac": "Q8IMY2", "gene_name": "Dmel\\CG31141", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q8IMY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IMY2" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q8IMY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IMY2" } ] } ] }, { "uniprot_ac": "Q8SXD1", "gene_name": "CG12138", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q8SXD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SXD1" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q8SXD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SXD1" } ] } ] }, { "uniprot_ac": "Q920L5", "gene_name": "Elovl6", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q920L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q920L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L5" } ] } ] }, { "uniprot_ac": "Q920L6", "gene_name": "Elovl6", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q920L6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L6" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q920L6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L6" } ] } ] }, { "uniprot_ac": "Q920L7", "gene_name": "Elovl5", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q920L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q920L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L7" } ] } ] }, { "uniprot_ac": "Q95T98", "gene_name": "CG9798", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q95T98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95T98" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q95T98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95T98" } ] } ] }, { "uniprot_ac": "Q9BW60", "gene_name": "ELOVL1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9BW60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BW60" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9BW60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BW60" } ] } ] }, { "uniprot_ac": "Q9D2Y9", "gene_name": "Elovl7", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9D2Y9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2Y9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9D2Y9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2Y9" } ] } ] }, { "uniprot_ac": "Q9EQC4", "gene_name": "Elovl4", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9EQC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EQC4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9EQC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EQC4" } ] } ] }, { "uniprot_ac": "Q9GZR5", "gene_name": "ELOVL4", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9GZR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9GZR5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9GZR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9GZR5" } ] } ] }, { "uniprot_ac": "Q9H5J4", "gene_name": "ELOVL6", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9H5J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H5J4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9H5J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H5J4" } ] } ] }, { "uniprot_ac": "Q9HB03", "gene_name": "ELOVL3", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9HB03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HB03" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9HB03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HB03" } ] } ] }, { "uniprot_ac": "Q9JLJ4", "gene_name": "Elovl2", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9JLJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLJ4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9JLJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLJ4" } ] } ] }, { "uniprot_ac": "Q9JLJ5", "gene_name": "Elovl1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9JLJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLJ5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9JLJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLJ5" } ] } ] }, { "uniprot_ac": "Q9NXB9", "gene_name": "ELOVL2", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9NXB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NXB9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9NXB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NXB9" } ] } ] }, { "uniprot_ac": "Q9NYP7", "gene_name": "ELOVL5", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9NYP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYP7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9NYP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYP7" } ] } ] }, { "uniprot_ac": "Q9VCT3", "gene_name": "Dmel\\CG6660", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCT3" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCT3" } ] } ] }, { "uniprot_ac": "Q9VCY5", "gene_name": "CG13844", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCY5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCY5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY5" } ] } ] }, { "uniprot_ac": "Q9VCY6", "gene_name": "sit", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY6" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY6" } ] } ] }, { "uniprot_ac": "Q9VCY7", "gene_name": "bond", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY7" } ] } ] }, { "uniprot_ac": "Q9VCZ0", "gene_name": "Dmel\\CG5326", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCZ0" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCZ0" } ] } ] }, { "uniprot_ac": "Q9VH55", "gene_name": "CT26802", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH55" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH55" } ] } ] }, { "uniprot_ac": "Q9VH57", "gene_name": "Dmel\\CG16904", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH57" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH57" } ] } ] }, { "uniprot_ac": "Q9VH58", "gene_name": "eloF", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH58" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH58" } ] } ] }, { "uniprot_ac": "Q9VH59", "gene_name": "Dmel\\CG8534", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH59", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH59" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH59", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH59" } ] } ] }, { "uniprot_ac": "Q9VHX7", "gene_name": "Elovl7", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VHX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHX7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VHX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHX7" } ] } ] }, { "uniprot_ac": "Q9VV87", "gene_name": "Baldspot", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VV87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VV87" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VV87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VV87" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }