{ "uniprot_canonical_ac": "D4AD00-1", "uniprot_ac": "D4AD00", "uniprot_id": "D4AD00_RAT", "mass": { "chemical_mass": 35187.0, "monoisotopic_mass": 35187.0 }, "refseq": { "ac": "NP_001000843", "name": "olfactory receptor Olr819", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000843" }, "gene_names": [ { "name": "Or2a51", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D4AD00", "id": "D4AD00" }, { "name": "Olr819", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000843", "id": "NP_001000843" }, { "name": "Or2a51", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000843", "id": "NP_001000843" } ], "protein_names": [ { "name": "Olfactory receptor", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "D4AD00" }, { "name": "olfactory receptor Olr819", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000843", "id": "NP_001000843" }, { "name": "olfactory receptor gene Olr819; olfactory receptor 819", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000843", "id": "NP_001000843" } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001000843", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000843" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D4AD00", "url": "https://www.uniprot.org/uniprot/D4AD00" } ], "common_name": "Rat" } ], "gene": [ { "name": "Or2a51", "url": "https://www.uniprot.org/uniprot/D4AD00", "locus": {} } ], "crossref": [ { "id": "cd15420", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15420", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "405132", "url": "https://www.ncbi.nlm.nih.gov/gene/405132", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:405132", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:405132", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NTECVLL", "url": "https://omabrowser.org/oma/group/NTECVLL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR26453", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26453", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR26453:SF704", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26453:SF704", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "http://pfam.xfam.org/family/PF13853", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-381753", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001000843", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000843", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1332872", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1332872", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "D4AD00", "url": "https://www.uniprot.org/uniprot/D4AD00", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4AD00-1", "url": "https://www.uniprot.org/uniprot/D4AD00-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEENQTMVTEFILLGFCLGPRIHIALFALFSLCYIFTLLGNGFTLGLICVEPRLHSPMYFFLSNLATVDIAYACNTVPQTLVNLLDETKSISFAGCMMQTYLFLTFANTECVLLVVMSYDRFVAIRHPLHYTVIMNWKVCTILAAVSWIVSFLLALVHLVLILKLPFCGPHVINHFFCEILSVLKLACADTTLNQVIIFAACVFALVGPLCFVLVSYTCILVAILRIQSGEGRRKAFSTCSSHLCVVGLFFGSAIVMYMAPKSQHPEEQQKILFLFYSFFNPMLNPLIYSLRNAEVKSALRRSLCNKNHSQLV", "length": 313, "header": "tr|D4AD00-1|D4AD00_RAT Isoform 1 of Olfactory receptor OS=Rattus norvegicus OX=10116 GN=Or2a51 PE=3 SV=2 CANONICAL=D4AD00-1" }, "isoforms": [ { "isoform_ac": "D4AD00-1", "url": "", "sequence": { "sequence": "MEENQTMVTEFILLGFCLGPRIHIALFALFSLCYIFTLLGNGFTLGLICVEPRLHSPMYFFLSNLATVDIAYACNTVPQTLVNLLDETKSISFAGCMMQTYLFLTFANTECVLLVVMSYDRFVAIRHPLHYTVIMNWKVCTILAAVSWIVSFLLALVHLVLILKLPFCGPHVINHFFCEILSVLKLACADTTLNQVIIFAACVFALVGPLCFVLVSYTCILVAILRIQSGEGRRKAFSTCSSHLCVVGLFFGSAIVMYMAPKSQHPEEQQKILFLFYSFFNPMLNPLIYSLRNAEVKSALRRSLCNKNHSQLV", "length": 313, "header": "tr|D4AD00-1|D4AD00_RAT Isoform 1 of Olfactory receptor OS=Rattus norvegicus OX=10116 GN=Or2a51 PE=3 SV=2 CANONICAL=D4AD00-1" }, "locus": { "chromosome": "4", "start_pos": 72013757, "end_pos": 72012819, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000007235.4", "url": "https://www.ensembl.org/id/ENSRNOT00000007235.4" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000007235.3", "url": "https://www.ensembl.org/id/ENSRNOP00000007235.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:405132", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:405132", "resource": "KEGG Pathway" }, { "id": "R-RNO-381753", "name": "Olfactory Signaling Pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-381753", "resource": "Reactome", "description": "Olfactory Signaling Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8NGT9-1", "protein_name": "Olfactory receptor 2A1/2A42", "gene_name": "OR2A42", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGENQTMVTEFLLLGFLLGPRIQMLLFGLFSLFYIFTLLGNGAILGLISLDSRLHTPMYFFLSHLAVVDIAYTRNTVPQMLANLLHPAKPISFAGCMTQTFLCLSFGHSECLLLVLMSYDRYVAICHPLRYSVIMTWRVCITLAVTSWTCGSLLALAHVVLILRLPFSGPHEINHFFCEILSVLRLACADTWLNQVVIFAACVFFLVGPPSLVLVSYSHILAAILRIQSGEGRRKAFSTCSSHLCVVGLFFGSAIIMYMAPKSRHPEEQQKVFFLFYSFFNPTLNPLIYSLRNGEVKGALRRALGKESHS", "length": 310 }, "evidence": [ { "id": "45224480", "url": "http://www.informatics.jax.org/homology/45224480", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8VFS3-1", "protein_name": "Olfactory receptor", "gene_name": "Or2a51", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKENQTMVTEFILLGFCLGPRIHVILFALFSVCYIFTLLGNGFTLGLICLEPRLHSPMYFFLSNLATVDIAYACNTVPQTLVNLLDETKPISFAGCMMQTYLFLTFGSTECVLLVVMSYDRYVAICHPLHYTVIMNWRVCTIMAAVSWIFSFLLALVHLVLILRLPFCGPHEVNHFFCEILSVLKLACADTTLNQVVIFAACVFALVGPLCLVLVSYTRILVTILRIQSGEGRRKAFSTCSSHLCVVGLFFGSAIVMYIAPKSQHPEELQKILFLFYSFFNPMLNPLIYSLRNAEVKGALRRSLCNENHSQLV", "length": 313 }, "evidence": [ { "id": "45224480", "url": "http://www.informatics.jax.org/homology/45224480", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "D4AD00", "url": "https://www.uniprot.org/uniprot/D4AD00" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "D4AD00", "url": "https://www.uniprot.org/uniprot/D4AD00" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "D4AD00", "url": "https://www.uniprot.org/uniprot/D4AD00" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "detection of chemical stimulus involved in sensory perception of smell", "id": "GO:0050911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050911", "evidence": [ { "database": "UniProtKB", "id": "D4AD00", "url": "https://www.uniprot.org/uniprot/D4AD00" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 308, "end_pos": 310, "annotation": "n_glycosylation_sequon" }, { "start_pos": 4, "end_pos": 6, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }