{ "uniprot_canonical_ac": "D4AC19-1", "uniprot_ac": "D4AC19", "uniprot_id": "D4AC19_RAT", "mass": { "chemical_mass": 26188.0, "monoisotopic_mass": 26188.0 }, "refseq": { "ac": "NP_001100510", "name": "homeobox protein DLX-4", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100510" }, "gene_names": [ { "name": "Dlx4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D4AC19", "id": "D4AC19" }, { "name": "Dlx4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100510", "id": "NP_001100510" } ], "protein_names": [ { "name": "Distal-less homeobox 4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D4AC19" }, { "name": "Homeodomain transcription factor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D4AC19" }, { "name": "homeobox protein DLX-4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100510", "id": "NP_001100510" } ], "function": [], "disease": [ { "disease_id": "DOID:0080408", "recommended_name": { "id": "DOID:0080408", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080408", "name": "orofacial cleft 15", "description": "An orofacial cleft that has_material_basis_in mutation in the DLX4 gene on chromosome 17q21." }, "synonyms": [ { "id": "MONDO:0014772", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014772", "name": "orofacial cleft 15", "description": "Any cleft lip/palate in which the cause of the disease is a mutation in the DLX4 gene." }, { "id": "MONDO:0014772", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014772", "name": "DLX4 cleft lip/palate", "description": "" }, { "id": "MONDO:0014772", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014772", "name": "OFC15", "description": "" }, { "id": "MONDO:0014772", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014772", "name": "cleft lip/palate caused by mutation in DLX4", "description": "" }, { "id": "MONDO:0014772", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014772", "name": "orofacial cleft 15", "description": "" }, { "id": "MONDO:0014772", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014772", "name": "orofacial cleft type 15", "description": "" }, { "id": "MIM:616788", "resource": "MIM", "url": "https://www.omim.org/entry/616788", "name": "Non-syndromic orofacial cleft 15", "description": "Non-syndromic orofacial cleft 15" } ], "evidence": [ { "id": "0080408", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080408" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D4AC19", "url": "https://www.uniprot.org/uniprot/D4AC19" } ], "common_name": "Rat" } ], "gene": [ { "name": "Dlx4", "url": "https://www.uniprot.org/uniprot/D4AC19", "locus": { "chromosome": "10", "start_pos": 80085465, "end_pos": 80090456, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000004399", "url": "https://www.ensembl.org/id/ENSRNOG00000004399" } ] } } ], "crossref": [ { "id": "ENSRNOG00000004399", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000004399", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00086", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00086", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "303469", "url": "https://www.ncbi.nlm.nih.gov/gene/303469", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000047", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000047", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001356", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001356", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017970", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017970", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020479", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020479", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:303469", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:303469", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "GNNFGAW", "url": "https://omabrowser.org/oma/group/GNNFGAW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2969529at2759", "url": "http://www.orthodb.org/?query=2969529at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24327", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24327", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24327:SF21", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24327:SF21", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00046", "url": "http://pfam.xfam.org/family/PF00046", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001100510", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100510", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1308744", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1308744", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "D4AC19", "url": "https://www.uniprot.org/uniprot/D4AC19", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4AC19-1", "url": "https://www.uniprot.org/uniprot/D4AC19-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTSLPCPLPGLGPSNVVFPDLAPASSVVAAYQLGLSPGTAASPDLSFSQTYGHLLSYSYPGPATPGDSYLSSQQQSAAPSRPFHQPTEHPQELEAESEKLALSLEPSQPSLTRKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQSSGELEEDFSGRPPSLSPHSLTLPSIWDLPKAGTLPTSGYDNSFGTWYQHHSPDVLALPQRM", "length": 238, "header": "tr|D4AC19-1|D4AC19_RAT Isoform 1 of Distal-less homeobox 4 OS=Rattus norvegicus OX=10116 GN=Dlx4 PE=2 SV=1 CANONICAL=D4AC19-1" }, "isoforms": [ { "isoform_ac": "D4AC19-1", "url": "", "sequence": { "sequence": "MTSLPCPLPGLGPSNVVFPDLAPASSVVAAYQLGLSPGTAASPDLSFSQTYGHLLSYSYPGPATPGDSYLSSQQQSAAPSRPFHQPTEHPQELEAESEKLALSLEPSQPSLTRKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQSSGELEEDFSGRPPSLSPHSLTLPSIWDLPKAGTLPTSGYDNSFGTWYQHHSPDVLALPQRM", "length": 238, "header": "tr|D4AC19-1|D4AC19_RAT Isoform 1 of Distal-less homeobox 4 OS=Rattus norvegicus OX=10116 GN=Dlx4 PE=2 SV=1 CANONICAL=D4AC19-1" }, "locus": { "chromosome": "10", "start_pos": 80090434, "end_pos": 80085955, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000005807.7", "url": "https://www.ensembl.org/id/ENSRNOT00000005807.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000005807.3", "url": "https://www.ensembl.org/id/ENSRNOP00000005807.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:303469", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:303469", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P70436-1", "protein_name": "Homeobox protein DLX-4", "gene_name": "Dlx4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTSLPCPLPDRGASNVVFPDLAPALSVVAAYPLGLSPGTAASPDLSYSQSYGHPRSYSHPGPATPGDSYLPRQQQLVAPSQPFHRPAEHPQELEAESEKLALSLVPSQQQSLTRKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQSSGEPEEDFSGRPPSLSPHSPALPFIWGLPKADTLPSSGYDNSHFGAWYQHRSPDVLALPQMM", "length": 240 }, "evidence": [ { "id": "45224443", "url": "http://www.informatics.jax.org/homology/45224443", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q92988-1", "protein_name": "Homeobox protein DLX-4", "gene_name": "DLX4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM", "length": 240 }, "evidence": [ { "id": "45224443", "url": "http://www.informatics.jax.org/homology/45224443", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "D4AC19", "url": "https://www.uniprot.org/uniprot/D4AC19" } ], "pmid": "" }, { "name": "cell differentiation", "id": "GO:0030154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030154", "evidence": [ { "database": "UniProtKB", "id": "D4AC19", "url": "https://www.uniprot.org/uniprot/D4AC19" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "D4AC19", "url": "https://www.uniprot.org/uniprot/D4AC19" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "DNA-binding transcription repressor activity, RNA polymerase II-specific", "id": "GO:0001227", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001227", "evidence": [ { "database": "UniProtKB", "id": "D4AC19", "url": "https://www.uniprot.org/uniprot/D4AC19" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "D4AC19", "url": "https://www.uniprot.org/uniprot/D4AC19" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "D4AC19", "url": "https://www.uniprot.org/uniprot/D4AC19" } ], "pmid": "" }, { "name": "sequence-specific DNA binding", "id": "GO:0043565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043565", "evidence": [ { "database": "UniProtKB", "id": "D4AC19", "url": "https://www.uniprot.org/uniprot/D4AC19" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "D4AC19", "url": "https://www.uniprot.org/uniprot/D4AC19" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }