{ "uniprot_canonical_ac": "D4AAV6-1", "uniprot_ac": "D4AAV6", "uniprot_id": "D4AAV6_RAT", "mass": { "chemical_mass": 30000.0, "monoisotopic_mass": 30000.0 }, "refseq": { "ac": "NP_001101052", "name": "programmed cell death 1 ligand 2 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101052" }, "gene_names": [ { "name": "Pdcd1lg2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D4AAV6", "id": "D4AAV6" }, { "name": "PD-L2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101052", "id": "NP_001101052" }, { "name": "Pdcd1lg2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101052", "id": "NP_001101052" } ], "protein_names": [ { "name": "PD-1 ligand 2; PDCD1 ligand 2; programmed death ligand 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101052", "id": "NP_001101052" }, { "name": "Programmed cell death 1 ligand 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D4AAV6" }, { "name": "programmed cell death 1 ligand 2 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101052", "id": "NP_001101052" } ], "function": [], "disease": [ { "disease_id": "DOID:2957", "recommended_name": { "id": "DOID:2957", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2957", "name": "pulmonary tuberculosis", "description": "A tuberculosis that is a contagious disease located_in lungs. The infection has_symptom fever, has_symptom cough, has_symptom difficulty in breathing, has_symptom inflammatory infiltrations, has_symptom formation of tubercles, has_symptom caseation, has_symptom pleural effusion, and has_symptom fibrosis." }, "synonyms": [], "evidence": [ { "id": "2957", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2957" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D4AAV6", "url": "https://www.uniprot.org/uniprot/D4AAV6" } ], "common_name": "Rat" } ], "gene": [ { "name": "Pdcd1lg2", "url": "https://www.uniprot.org/uniprot/D4AAV6", "locus": { "chromosome": "1", "start_pos": 227223938, "end_pos": 227158941, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000016136", "url": "https://www.ensembl.org/id/ENSRNOG00000016136" } ] } } ], "crossref": [ { "id": "ENSRNOG00000016136", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000016136", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd20983", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20983", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "309304", "url": "https://www.ncbi.nlm.nih.gov/gene/309304", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013162", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013162", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:309304", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:309304", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "EVSWPDI", "url": "https://omabrowser.org/oma/group/EVSWPDI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5315576at2759", "url": "http://www.orthodb.org/?query=5315576at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR25466", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR25466", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR25466:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR25466:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF08205", "url": "http://pfam.xfam.org/family/PF08205", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-389948", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001101052", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101052", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1306403", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1306403", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "D4AAV6", "url": "https://www.uniprot.org/uniprot/D4AAV6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4AAV6-1", "url": "https://www.uniprot.org/uniprot/D4AAV6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLLLLLILNLSSQLHHIAALFTVTAPKEVYTVDFGSSVSLECDFDRRECTELEGIRASLQKVENDTSSQSQRATLLEELLPLGKASFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYVRIDTGILEVPGTGEVQLICQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPNRNFSCMFWNAHMKELTSAIIDPLSWMEPKVPRTRSLHAFIPACTVALIFLATVIAQRKRLWGKLYSRKRSEPAVLGVGKIQ", "length": 268, "header": "tr|D4AAV6-1|D4AAV6_RAT Isoform 1 of Programmed cell death 1 ligand 2 OS=Rattus norvegicus OX=10116 GN=Pdcd1lg2 PE=4 SV=2 CANONICAL=D4AAV6-1" }, "isoforms": [ { "isoform_ac": "D4AAV6-1", "url": "", "sequence": { "sequence": "MLLLLLILNLSSQLHHIAALFTVTAPKEVYTVDFGSSVSLECDFDRRECTELEGIRASLQKVENDTSSQSQRATLLEELLPLGKASFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYVRIDTGILEVPGTGEVQLICQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPNRNFSCMFWNAHMKELTSAIIDPLSWMEPKVPRTRSLHAFIPACTVALIFLATVIAQRKRLWGKLYSRKRSEPAVLGVGKIQ", "length": 268, "header": "tr|D4AAV6-1|D4AAV6_RAT Isoform 1 of Programmed cell death 1 ligand 2 OS=Rattus norvegicus OX=10116 GN=Pdcd1lg2 PE=4 SV=2 CANONICAL=D4AAV6-1" }, "locus": { "chromosome": "1", "start_pos": 227223358, "end_pos": 227177916, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000021614.7", "url": "https://www.ensembl.org/id/ENSRNOT00000021614.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000021615.6", "url": "https://www.ensembl.org/id/ENSRNOP00000021615.6" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:309304", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:309304", "resource": "KEGG Pathway" }, { "id": "R-RNO-389948", "name": "PD-1 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-389948", "resource": "Reactome", "description": "PD-1 signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9BQ51-1", "protein_name": "Programmed cell death 1 ligand 2", "gene_name": "PDCD1LG2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPTWLLHIFIPFCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI", "length": 273 }, "evidence": [ { "id": "45239358", "url": "http://www.informatics.jax.org/homology/45239358", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9WUL5-1", "protein_name": "Programmed cell death 1 ligand 2", "gene_name": "Pdcd1lg2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MLLLLPILNLSLQLHPVAALFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPRTWPLHVFIPACTIALIFLAIVIIQRKRI", "length": 247 }, "evidence": [ { "id": "45239358", "url": "http://www.informatics.jax.org/homology/45239358", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 9, "go_terms": [ { "name": "negative regulation of interleukin-10 production", "id": "GO:0032693", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032693", "evidence": [ { "database": "UniProtKB", "id": "D4AAV6", "url": "https://www.uniprot.org/uniprot/D4AAV6" } ], "pmid": "" }, { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "D4AAV6", "url": "https://www.uniprot.org/uniprot/D4AAV6" } ], "pmid": "" }, { "name": "cell surface receptor signaling pathway", "id": "GO:0007166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007166", "evidence": [ { "database": "UniProtKB", "id": "D4AAV6", "url": "https://www.uniprot.org/uniprot/D4AAV6" } ], "pmid": "" }, { "name": "T cell costimulation", "id": "GO:0031295", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031295", "evidence": [ { "database": "UniProtKB", "id": "D4AAV6", "url": "https://www.uniprot.org/uniprot/D4AAV6" } ], "pmid": "" }, { "name": "negative regulation of type II interferon production", "id": "GO:0032689", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032689", "evidence": [ { "database": "UniProtKB", "id": "D4AAV6", "url": "https://www.uniprot.org/uniprot/D4AAV6" } ], "pmid": "" }, { "name": "negative regulation of T cell proliferation", "id": "GO:0042130", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042130", "evidence": [ { "database": "UniProtKB", "id": "D4AAV6", "url": "https://www.uniprot.org/uniprot/D4AAV6" } ], "pmid": "" }, { "name": "cellular response to lipopolysaccharide", "id": "GO:0071222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071222", "evidence": [ { "database": "UniProtKB", "id": "D4AAV6", "url": "https://www.uniprot.org/uniprot/D4AAV6" } ], "pmid": "" }, { "name": "positive regulation of T cell proliferation", "id": "GO:0042102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042102", "evidence": [ { "database": "UniProtKB", "id": "D4AAV6", "url": "https://www.uniprot.org/uniprot/D4AAV6" } ], "pmid": "" }, { "name": "negative regulation of activated T cell proliferation", "id": "GO:0046007", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046007", "evidence": [ { "database": "UniProtKB", "id": "D4AAV6", "url": "https://www.uniprot.org/uniprot/D4AAV6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "D4AAV6", "url": "https://www.uniprot.org/uniprot/D4AAV6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 157, "end_pos": 159, "annotation": "n_glycosylation_sequon" }, { "start_pos": 163, "end_pos": 165, "annotation": "n_glycosylation_sequon" }, { "start_pos": 189, "end_pos": 191, "annotation": "n_glycosylation_sequon" }, { "start_pos": 64, "end_pos": 66, "annotation": "n_glycosylation_sequon" }, { "start_pos": 9, "end_pos": 11, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }