{ "uniprot_canonical_ac": "D4A8M5-1", "uniprot_ac": "D4A8M5", "uniprot_id": "D4A8M5_RAT", "mass": { "chemical_mass": 10834.0, "monoisotopic_mass": 10834.0 }, "refseq": {}, "gene_names": [ { "name": "Snrpepl2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D4A8M5", "id": "D4A8M5" }, { "name": "Snrpep2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/D4A8M5", "id": "D4A8M5" } ], "protein_names": [ { "name": "Small nuclear ribonucleoprotein E", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "D4A8M5" }, { "name": "Sm protein E", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D4A8M5" }, { "name": "snRNP-E", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D4A8M5" } ], "function": [ { "annotation": "Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs. As part of the U7 snRNP it is involved in histone 3'-end processing.", "evidence": [ { "database": "UniProtKB", "id": "D4A8M5", "url": "https://www.uniprot.org/uniprot/D4A8M5#function" }, { "database": "UniProtKB", "id": "RU365053", "url": "https://www.uniprot.org/uniprot/RU365053#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D4A8M5", "url": "https://www.uniprot.org/uniprot/D4A8M5" } ], "common_name": "Rat" } ], "gene": [ { "name": "Snrpepl2", "url": "https://www.uniprot.org/uniprot/D4A8M5", "locus": {} } ], "crossref": [ { "id": "ENSRNOG00000034206", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000034206", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd01718", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01718", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR001163", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001163", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010920", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010920", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027078", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027078", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047575", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047575", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "FFADFRI", "url": "https://omabrowser.org/oma/group/FFADFRI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR11193", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11193", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11193:SF9", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11193:SF9", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01423", "url": "http://pfam.xfam.org/family/PF01423", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "2318883", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=2318883", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "D4A8M5", "url": "https://www.uniprot.org/uniprot/D4A8M5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4A8M5-1", "url": "https://www.uniprot.org/uniprot/D4A8M5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMQIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN", "length": 92, "header": "tr|D4A8M5-1|D4A8M5_RAT Isoform 1 of Small nuclear ribonucleoprotein E OS=Rattus norvegicus OX=10116 GN=Snrpepl2 PE=3 SV=1 CANONICAL=D4A8M5-1" }, "isoforms": [ { "isoform_ac": "D4A8M5-1", "url": "", "sequence": { "sequence": "MEYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMQIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN", "length": 92, "header": "tr|D4A8M5-1|D4A8M5_RAT Isoform 1 of Small nuclear ribonucleoprotein E OS=Rattus norvegicus OX=10116 GN=Snrpepl2 PE=3 SV=1 CANONICAL=D4A8M5-1" }, "locus": { "chromosome": "1", "start_pos": 133710075, "end_pos": 133709800, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000040164.2", "url": "https://www.ensembl.org/id/ENSRNOT00000040164.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000042416.1", "url": "https://www.ensembl.org/id/ENSRNOP00000042416.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "U1 snRNP", "id": "GO:0005685", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005685", "evidence": [ { "database": "UniProtKB", "id": "D4A8M5", "url": "https://www.uniprot.org/uniprot/D4A8M5" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "D4A8M5", "url": "https://www.uniprot.org/uniprot/D4A8M5" } ], "pmid": "" }, { "name": "U2 snRNP", "id": "GO:0005686", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005686", "evidence": [ { "database": "UniProtKB", "id": "D4A8M5", "url": "https://www.uniprot.org/uniprot/D4A8M5" } ], "pmid": "" }, { "name": "pICln-Sm protein complex", "id": "GO:0034715", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034715", "evidence": [ { "database": "UniProtKB", "id": "D4A8M5", "url": "https://www.uniprot.org/uniprot/D4A8M5" } ], "pmid": "" }, { "name": "precatalytic spliceosome", "id": "GO:0071011", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071011", "evidence": [ { "database": "UniProtKB", "id": "D4A8M5", "url": "https://www.uniprot.org/uniprot/D4A8M5" } ], "pmid": "" }, { "name": "U4 snRNP", "id": "GO:0005687", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005687", "evidence": [ { "database": "UniProtKB", "id": "D4A8M5", "url": "https://www.uniprot.org/uniprot/D4A8M5" } ], "pmid": "" }, { "name": "U5 snRNP", "id": "GO:0005682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005682", "evidence": [ { "database": "UniProtKB", "id": "D4A8M5", "url": "https://www.uniprot.org/uniprot/D4A8M5" } ], "pmid": "" }, { "name": "U4/U6 x U5 tri-snRNP complex", "id": "GO:0046540", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046540", "evidence": [ { "database": "UniProtKB", "id": "D4A8M5", "url": "https://www.uniprot.org/uniprot/D4A8M5" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "D4A8M5", "url": "https://www.uniprot.org/uniprot/D4A8M5" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "spliceosomal snRNP assembly", "id": "GO:0000387", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000387", "evidence": [ { "database": "UniProtKB", "id": "D4A8M5", "url": "https://www.uniprot.org/uniprot/D4A8M5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 27, "end_pos": 29, "annotation": "n_glycosylation_sequon" }, { "start_pos": 83, "end_pos": 85, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }