{ "uniprot_canonical_ac": "D4A897-1", "uniprot_ac": "D4A897", "uniprot_id": "D4A897_RAT", "mass": { "chemical_mass": 18216.0, "monoisotopic_mass": 18216.0 }, "refseq": {}, "gene_names": [ { "name": "Mrap", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D4A897", "id": "D4A897" } ], "protein_names": [ { "name": "Melanocortin 2 receptor accessory protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D4A897" } ], "function": [], "disease": [ { "disease_id": "DOID:0080620", "recommended_name": { "id": "DOID:0080620", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080620", "name": "familial glucocorticoid deficiency", "description": "An adrenal cortex disease that is characterized by insufficent production of glucocorticoids." }, "synonyms": [ { "id": "MONDO:0024536", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024536", "name": "glucocorticoid deficiency 1", "description": "Any familial glucocorticoid deficiency in which the cause of the disease is a mutation in the MC2R gene." }, { "id": "MONDO:0024536", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024536", "name": "MC2R familial glucocorticoid deficiency", "description": "" }, { "id": "MONDO:0024536", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024536", "name": "familial glucocorticoid deficiency caused by mutation in MC2R", "description": "" }, { "id": "MONDO:0024536", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024536", "name": "glucocorticoid deficiency 1", "description": "" }, { "id": "MONDO:0024536", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024536", "name": "glucocorticoid deficiency, due to ACTH unresponsiveness", "description": "" }, { "id": "MONDO:0024536", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024536", "name": "ACTH resistance", "description": "" }, { "id": "MONDO:0024536", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024536", "name": "GCCD1", "description": "" }, { "id": "MONDO:0024536", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024536", "name": "adrenal unresponsiveness to ACTH", "description": "" }, { "id": "MONDO:0024536", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024536", "name": "familial glucocorticoid deficiency 1", "description": "" }, { "id": "MIM:202200", "resource": "MIM", "url": "https://www.omim.org/entry/202200", "name": "Glucocorticoid deficiency 1", "description": "Glucocorticoid deficiency 1" } ], "evidence": [ { "id": "0080620", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080620" } ] }, { "disease_id": "DOID:9553", "recommended_name": { "id": "DOID:9553", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9553", "name": "adrenal gland disease", "description": "An endocrine system disease that is located_in the adrenal gland." }, "synonyms": [], "evidence": [ { "id": "9553", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9553" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D4A897", "url": "https://www.uniprot.org/uniprot/D4A897" } ], "common_name": "Rat" } ], "gene": [ { "name": "Mrap", "url": "https://www.uniprot.org/uniprot/D4A897", "locus": { "chromosome": "11", "start_pos": 30003024, "end_pos": 29992034, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000021524", "url": "https://www.ensembl.org/id/ENSRNOG00000021524" } ] } } ], "crossref": [ { "id": "ENSRNOG00000021524", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000021524", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR028111", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028111", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:288271", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:288271", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "CHREPLG", "url": "https://omabrowser.org/oma/group/CHREPLG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5358677at2759", "url": "http://www.orthodb.org/?query=5358677at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR28675", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28675", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR28675:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28675:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15183", "url": "http://pfam.xfam.org/family/PF15183", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "1310648", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1310648", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "D4A897", "url": "https://www.uniprot.org/uniprot/D4A897", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4A897-1", "url": "https://www.uniprot.org/uniprot/D4A897-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPGDPQTSPGDSDRNQLPNRVSGAHSPPPGVWPLTDTAMANRTDASVPFTSYEYYLDYIDLIPVDEKKLKANKHSIVIALWLSLATFVVLLFFILLYMSWSGSPQVRHSPQAYQVCSWTHGFHLPLCLRRASLQTTDEPGSRAGIDQWLQQQSPSASPAGPLALP", "length": 165, "header": "tr|D4A897-1|D4A897_RAT Isoform 1 of Melanocortin 2 receptor accessory protein OS=Rattus norvegicus OX=10116 GN=Mrap PE=3 SV=2 CANONICAL=D4A897-1" }, "isoforms": [ { "isoform_ac": "D4A897-1", "url": "", "sequence": { "sequence": "MPGDPQTSPGDSDRNQLPNRVSGAHSPPPGVWPLTDTAMANRTDASVPFTSYEYYLDYIDLIPVDEKKLKANKHSIVIALWLSLATFVVLLFFILLYMSWSGSPQVRHSPQAYQVCSWTHGFHLPLCLRRASLQTTDEPGSRAGIDQWLQQQSPSASPAGPLALP", "length": 165, "header": "tr|D4A897-1|D4A897_RAT Isoform 1 of Melanocortin 2 receptor accessory protein OS=Rattus norvegicus OX=10116 GN=Mrap PE=3 SV=2 CANONICAL=D4A897-1" }, "locus": { "chromosome": "11", "start_pos": 30002647, "end_pos": 29992493, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000036027.5", "url": "https://www.ensembl.org/id/ENSRNOT00000036027.5" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000030039.5", "url": "https://www.ensembl.org/id/ENSRNOP00000030039.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:288271", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:288271", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "D4A897", "url": "https://www.uniprot.org/uniprot/D4A897" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "D4A897", "url": "https://www.uniprot.org/uniprot/D4A897" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "D4A897", "url": "https://www.uniprot.org/uniprot/D4A897" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 7, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "D4A897", "url": "https://www.uniprot.org/uniprot/D4A897" } ], "pmid": "" }, { "name": "type 3 melanocortin receptor binding", "id": "GO:0031781", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031781", "evidence": [ { "database": "UniProtKB", "id": "D4A897", "url": "https://www.uniprot.org/uniprot/D4A897" } ], "pmid": "" }, { "name": "type 4 melanocortin receptor binding", "id": "GO:0031782", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031782", "evidence": [ { "database": "UniProtKB", "id": "D4A897", "url": "https://www.uniprot.org/uniprot/D4A897" } ], "pmid": "" }, { "name": "type 1 melanocortin receptor binding", "id": "GO:0070996", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070996", "evidence": [ { "database": "UniProtKB", "id": "D4A897", "url": "https://www.uniprot.org/uniprot/D4A897" } ], "pmid": "" }, { "name": "corticotropin hormone receptor binding", "id": "GO:0031780", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031780", "evidence": [ { "database": "UniProtKB", "id": "D4A897", "url": "https://www.uniprot.org/uniprot/D4A897" } ], "pmid": "" }, { "name": "type 5 melanocortin receptor binding", "id": "GO:0031783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031783", "evidence": [ { "database": "UniProtKB", "id": "D4A897", "url": "https://www.uniprot.org/uniprot/D4A897" } ], "pmid": "" }, { "name": "signaling receptor regulator activity", "id": "GO:0030545", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030545", "evidence": [ { "database": "UniProtKB", "id": "D4A897", "url": "https://www.uniprot.org/uniprot/D4A897" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "brown fat cell differentiation", "id": "GO:0050873", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050873", "evidence": [ { "database": "UniProtKB", "id": "D4A897", "url": "https://www.uniprot.org/uniprot/D4A897" } ], "pmid": "" }, { "name": "protein localization to plasma membrane", "id": "GO:0072659", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072659", "evidence": [ { "database": "UniProtKB", "id": "D4A897", "url": "https://www.uniprot.org/uniprot/D4A897" } ], "pmid": "" }, { "name": "negative regulation of protein localization to plasma membrane", "id": "GO:1903077", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903077", "evidence": [ { "database": "UniProtKB", "id": "D4A897", "url": "https://www.uniprot.org/uniprot/D4A897" } ], "pmid": "" }, { "name": "positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway", "id": "GO:0106071", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106071", "evidence": [ { "database": "UniProtKB", "id": "D4A897", "url": "https://www.uniprot.org/uniprot/D4A897" } ], "pmid": "" }, { "name": "negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway", "id": "GO:0106072", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106072", "evidence": [ { "database": "UniProtKB", "id": "D4A897", "url": "https://www.uniprot.org/uniprot/D4A897" } ], "pmid": "" }, { "name": "regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway", "id": "GO:0106070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106070", "evidence": [ { "database": "UniProtKB", "id": "D4A897", "url": "https://www.uniprot.org/uniprot/D4A897" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 41, "end_pos": 43, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }