{ "uniprot_canonical_ac": "D4A571-1", "uniprot_ac": "D4A571", "uniprot_id": "D4A571_RAT", "mass": { "chemical_mass": 35146.0, "monoisotopic_mass": 35146.0 }, "refseq": { "ac": "NP_001000815", "name": "olfactory receptor Olr1213", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000815" }, "gene_names": [ { "name": "Or8b101", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D4A571", "id": "D4A571" }, { "name": "Olr1213", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000815", "id": "NP_001000815" }, { "name": "Or8b101", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000815", "id": "NP_001000815" } ], "protein_names": [ { "name": "Olfactory receptor 1213", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D4A571" }, { "name": "olfactory receptor Olr1213", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000815", "id": "NP_001000815" }, { "name": "olfactory receptor gene Olr1213; olfactory receptor 1213", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000815", "id": "NP_001000815" } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001000815", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000815" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D4A571", "url": "https://www.uniprot.org/uniprot/D4A571" } ], "common_name": "Rat" } ], "gene": [ { "name": "Or8b101", "url": "https://www.uniprot.org/uniprot/D4A571", "locus": {} } ], "crossref": [ { "id": "405101", "url": "https://www.ncbi.nlm.nih.gov/gene/405101", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:405101", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:405101", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "VIMSHQI", "url": "https://omabrowser.org/oma/group/VIMSHQI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4830110at2759", "url": "http://www.orthodb.org/?query=4830110at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR48018", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48018", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48018:SF152", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48018:SF152", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "http://pfam.xfam.org/family/PF13853", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001000815", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000815", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1333164", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1333164", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "D4A571", "url": "https://www.uniprot.org/uniprot/D4A571", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4A571-1", "url": "https://www.uniprot.org/uniprot/D4A571-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTLGRMTFSNDSSVKEFVLLGLTQQPELQPPLFFLFLGIYVVSRVGNLGLIVLIVLNPHLHTPMYYFLFTLSFIDFCYSTVITPRMLVGFVKQNIISHAECMTQLFFFCFFVIDECYILTAMAYDRYAAICKPLLYQVTMSHQVCHLMMVGVYVMGLVGAMAHTGSMLTLTFCDGNIINHYMCDIPPLQKLSCTSTSTNELVVFIVVGVNVIIPSLTVFISYTLILSNILSIRSAEGRSKAFSTCGSHVIAVSLFYGASAFMYLKPSSASVDDDKVSTIFYTIVGPMLNPFIYSLRNKDVHIALRKTLKKSIFI", "length": 314, "header": "tr|D4A571-1|D4A571_RAT Isoform 1 of Olfactory receptor 1213 OS=Rattus norvegicus OX=10116 GN=Or8b101 PE=4 SV=3 CANONICAL=D4A571-1" }, "isoforms": [ { "isoform_ac": "D4A571-1", "url": "", "sequence": { "sequence": "MTLGRMTFSNDSSVKEFVLLGLTQQPELQPPLFFLFLGIYVVSRVGNLGLIVLIVLNPHLHTPMYYFLFTLSFIDFCYSTVITPRMLVGFVKQNIISHAECMTQLFFFCFFVIDECYILTAMAYDRYAAICKPLLYQVTMSHQVCHLMMVGVYVMGLVGAMAHTGSMLTLTFCDGNIINHYMCDIPPLQKLSCTSTSTNELVVFIVVGVNVIIPSLTVFISYTLILSNILSIRSAEGRSKAFSTCGSHVIAVSLFYGASAFMYLKPSSASVDDDKVSTIFYTIVGPMLNPFIYSLRNKDVHIALRKTLKKSIFI", "length": 314, "header": "tr|D4A571-1|D4A571_RAT Isoform 1 of Olfactory receptor 1213 OS=Rattus norvegicus OX=10116 GN=Or8b101 PE=4 SV=3 CANONICAL=D4A571-1" }, "locus": { "chromosome": "8", "start_pos": 37994608, "end_pos": 37993667, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000047933.4", "url": "https://www.ensembl.org/id/ENSRNOT00000047933.4" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000042306.3", "url": "https://www.ensembl.org/id/ENSRNOP00000042306.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:405101", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:405101", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A1D5RLR5-1", "protein_name": "Olfactory receptor family 8 subfamily B member 101", "gene_name": "Or8b101", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAFSNDSSVKEFILLGLTQQPELQMPLFFLFLGIYVVSMVGNLGLIVLIVLNPHLHTPMYYFLFNLSFIDLCYSSVITPRMLVGFVKQNIISHAECMTQLFFFCFFVIDECYILTAMAYDRYAAICKPLLYQVTMSHQVCHLMMVGVYVMGLVGAMAHTGSMLSLTFCDGNIINHYMCDIPPLQKLSCTSTSINELVVFIVVGVNVIIPSLTVFISYTLILSNILSIQSAEGRSKAFSTCGSHVIAVSLFFGASAFMYLKPSSASVDDDKISTIFYTIVGPMLNPFIYSLRNKDVHIALRKTLKKSMFI", "length": 309 }, "evidence": [ { "id": "45245468", "url": "http://www.informatics.jax.org/homology/45245468", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "D4A571", "url": "https://www.uniprot.org/uniprot/D4A571" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "D4A571", "url": "https://www.uniprot.org/uniprot/D4A571" } ], "pmid": "" }, { "name": "odorant binding", "id": "GO:0005549", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005549", "evidence": [ { "database": "UniProtKB", "id": "D4A571", "url": "https://www.uniprot.org/uniprot/D4A571" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "D4A571", "url": "https://www.uniprot.org/uniprot/D4A571" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "D4A571", "url": "https://www.uniprot.org/uniprot/D4A571" } ], "pmid": "" }, { "name": "sensory perception of smell", "id": "GO:0007608", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007608", "evidence": [ { "database": "UniProtKB", "id": "D4A571", "url": "https://www.uniprot.org/uniprot/D4A571" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 10, "end_pos": 12, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }