{ "uniprot_canonical_ac": "D4A4Q6-1", "uniprot_ac": "D4A4Q6", "uniprot_id": "D4A4Q6_RAT", "mass": { "chemical_mass": 19174.0, "monoisotopic_mass": 19174.0 }, "refseq": { "ac": "XP_017451516", "name": "cilia- and flagella-associated protein HOATZ", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017451516" }, "gene_names": [ { "name": "Hoatz", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D4A4Q6", "id": "D4A4Q6" }, { "name": "Hoatz", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017451516", "id": "XP_017451516" }, { "name": "LOC100359479", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/D4A4Q6", "id": "D4A4Q6" } ], "protein_names": [ { "name": "Cilia- and flagella-associated protein HOATZ", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "D4A4Q6" }, { "name": "cilia- and flagella-associated protein HOATZ", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017451516", "id": "XP_017451516" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D4A4Q6", "url": "https://www.uniprot.org/uniprot/D4A4Q6" } ], "common_name": "Rat" } ], "gene": [ { "name": "Hoatz", "url": "https://www.uniprot.org/uniprot/D4A4Q6", "locus": { "chromosome": "8", "start_pos": 51388382, "end_pos": 51412514, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000043383", "url": "https://www.ensembl.org/id/ENSRNOG00000043383" } ] } } ], "crossref": [ { "id": "ENSRNOG00000043383", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000043383", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "100359479", "url": "https://www.ncbi.nlm.nih.gov/gene/100359479", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR040681", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040681", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:100359479", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:100359479", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "YAAMGDQ", "url": "https://omabrowser.org/oma/group/YAAMGDQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2952017at2759", "url": "http://www.orthodb.org/?query=2952017at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR47231", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47231", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR47231:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47231:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF17664", "url": "http://pfam.xfam.org/family/PF17664", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_017451516", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017451516", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "2323814", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=2323814", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I6AAL4", "url": "https://www.uniprot.org/uniprot/A0A8I6AAL4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AAL4-1", "url": "https://www.uniprot.org/uniprot/A0A8I6AAL4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4A4Q6", "url": "https://www.uniprot.org/uniprot/D4A4Q6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4A4Q6-1", "url": "https://www.uniprot.org/uniprot/D4A4Q6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "METGPRGCPSVRKEPQEICSPGLLVFTGCSEQDANLAKQFWLGASMYPTTESQLVLTRGSSQRLPVARNSKVLVSERNSVKPFPFDHNKEEILFAKAQKVQESEEKANYLQKAKKRDEILQLLRKQREERILKELISLPYKPKAKMPKSEEVLSESDLKDQEEVKALE", "length": 168, "header": "tr|D4A4Q6-1|D4A4Q6_RAT Isoform 1 of Cilia- and flagella-associated protein HOATZ OS=Rattus norvegicus OX=10116 GN=Hoatz PE=3 SV=1 CANONICAL=D4A4Q6-1" }, "isoforms": [ { "isoform_ac": "A0A8I6AAL4-1", "url": "", "sequence": { "sequence": "METGPRGCPSVRKEPQEICSPGLLVFTGCSEQDANLAKQFWLGASMYPTTESQLVLTRGSSQRLPVARNSKVLVSERNSVKPFPFDHNKEEILFAKAQKVQESEEKANYLQKAKKRDEILQLLRKQREERILKELISLPYKPKAKMPKSDFVSLLMWDDL", "length": 160, "header": "tr|A0A8I6AAL4-1|A0A8I6AAL4_RAT Computationally mapped isoform of Cilia- and flagella-associated protein HOATZ OS=Rattus norvegicus OX=10116 GN=Hoatz PE=3 SV=1 CANONICAL=D4A4Q6-1" }, "locus": { "chromosome": "8", "start_pos": 51408662, "end_pos": 51390066, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000119290.1", "url": "https://www.ensembl.org/id/ENSRNOT00000119290.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000086638.1", "url": "https://www.ensembl.org/id/ENSRNOP00000086638.1" } ] } }, { "isoform_ac": "D4A4Q6-1", "url": "", "sequence": { "sequence": "METGPRGCPSVRKEPQEICSPGLLVFTGCSEQDANLAKQFWLGASMYPTTESQLVLTRGSSQRLPVARNSKVLVSERNSVKPFPFDHNKEEILFAKAQKVQESEEKANYLQKAKKRDEILQLLRKQREERILKELISLPYKPKAKMPKSEEVLSESDLKDQEEVKALE", "length": 168, "header": "tr|D4A4Q6-1|D4A4Q6_RAT Isoform 1 of Cilia- and flagella-associated protein HOATZ OS=Rattus norvegicus OX=10116 GN=Hoatz PE=3 SV=1 CANONICAL=D4A4Q6-1" }, "locus": { "chromosome": "8", "start_pos": 51408662, "end_pos": 51388545, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000014965.5", "url": "https://www.ensembl.org/id/ENSRNOT00000014965.5" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000014965.3", "url": "https://www.ensembl.org/id/ENSRNOP00000014965.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:100359479", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:100359479", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q6PI97-1", "protein_name": "Cilia- and flagella-associated protein HOATZ", "gene_name": "HOATZ", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "METGPSEEPSGRKESQEMCPPGLLVFAGSSEQDANLAKQFWISASMYPPSESQLVLRRDSSQRLPVARPRRSRGSENSHSSQSFHLASNKNRDIFAEALKIQESEEKVKYLQKAKTREEILQLLRKQREERISKELISLPYKPKAKEHKAKKVVSESDKEDQEEVKTLD", "length": 169 }, "evidence": [ { "id": "45240107", "url": "http://www.informatics.jax.org/homology/45240107", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q80Y73-1", "protein_name": "Cilia- and flagella-associated protein HOATZ", "gene_name": "Hoatz", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "METGPRGCPSGRKESQEICSPGLLVFTGCSEQDANLAKQFWLGASMYPTTESQLVLTRGSSQRLPVARNSKVVLREKSSVQPFPFDQDKDAIIFAKAQRIQESEERAKYLQKAKTRDEILQLLRKQREERISKELISLPYKPKDKVPKSKEVLSESGLRDQEEVKALE", "length": 168 }, "evidence": [ { "id": "45240107", "url": "http://www.informatics.jax.org/homology/45240107", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "D4A4Q6", "url": "https://www.uniprot.org/uniprot/D4A4Q6" } ], "pmid": "" }, { "name": "cilium", "id": "GO:0005929", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005929", "evidence": [ { "database": "UniProtKB", "id": "D4A4Q6", "url": "https://www.uniprot.org/uniprot/D4A4Q6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "spermatogenesis", "id": "GO:0007283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "database": "UniProtKB", "id": "D4A4Q6", "url": "https://www.uniprot.org/uniprot/D4A4Q6" } ], "pmid": "" }, { "name": "flagellated sperm motility", "id": "GO:0030317", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030317", "evidence": [ { "database": "UniProtKB", "id": "D4A4Q6", "url": "https://www.uniprot.org/uniprot/D4A4Q6" } ], "pmid": "" }, { "name": "cilium assembly", "id": "GO:0060271", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060271", "evidence": [ { "database": "UniProtKB", "id": "D4A4Q6", "url": "https://www.uniprot.org/uniprot/D4A4Q6" } ], "pmid": "" }, { "name": "axoneme assembly", "id": "GO:0035082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035082", "evidence": [ { "database": "UniProtKB", "id": "D4A4Q6", "url": "https://www.uniprot.org/uniprot/D4A4Q6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }