{ "uniprot_canonical_ac": "D4A3M4-1", "uniprot_ac": "D4A3M4", "uniprot_id": "D4A3M4_RAT", "mass": { "chemical_mass": 44565.0, "monoisotopic_mass": 44565.0 }, "refseq": { "ac": "NP_001100406", "name": "terminal nucleotidyltransferase 5D", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100406" }, "gene_names": [ { "name": "Tent5d", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D4A3M4", "id": "D4A3M4" }, { "name": "Fam46d; RGD1559589", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100406", "id": "NP_001100406" }, { "name": "Fam46d", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/D4A3M4", "id": "D4A3M4" }, { "name": "Tent5d", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100406", "id": "NP_001100406" } ], "protein_names": [ { "name": "polynucleotide adenylyltransferase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "D4A3M4" }, { "name": "2.7.7.19", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D4A3M4" }, { "name": "family with sequence similarity 46, member D", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100406", "id": "NP_001100406" }, { "name": "terminal nucleotidyltransferase 5D", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100406", "id": "NP_001100406" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D4A3M4", "url": "https://www.uniprot.org/uniprot/D4A3M4" } ], "common_name": "Rat" } ], "gene": [ { "name": "Tent5d", "url": "https://www.uniprot.org/uniprot/D4A3M4", "locus": { "chromosome": "X", "start_pos": 72970573, "end_pos": 72901241, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000023637", "url": "https://www.ensembl.org/id/ENSRNOG00000023637" } ] } } ], "crossref": [ { "id": "ENSRNOG00000023637", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000023637", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "302368", "url": "https://www.ncbi.nlm.nih.gov/gene/302368", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR012937", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012937", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:302368", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:302368", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "KVCNKHD", "url": "https://omabrowser.org/oma/group/KVCNKHD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2946602at2759", "url": "http://www.orthodb.org/?query=2946602at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12974", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12974", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12974:SF30", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12974:SF30", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07984", "url": "http://pfam.xfam.org/family/PF07984", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001100406", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100406", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1559589", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1559589", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "11332", "url": "https://www.rhea-db.org/rhea/11332", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "D4A3M4", "url": "https://www.uniprot.org/uniprot/D4A3M4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4A3M4-1", "url": "https://www.uniprot.org/uniprot/D4A3M4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSEIRFSNLTWDHIVTLDRVLDEVIPIHGRGNFPTLEVKPKDIVHVVKDQLIKQGIIVKDTRLNGSTASYILASHNGISYKDLDIIFGVDLPSDQEFQVVKDAVLGCLLDFLPKGVKKEKITLKTMKEAYVQKMVKICSNNDRWSLISLSNNTGKNVELKFVNSLRRQFEFSVDSFQILLDSMLDFYSVPNAKLTKESCPVVVAESMYGDFQEAMVHLKYKLISTRKPEEIRGGGLLKYSNLLVRDFKPACQTEIKTLERYMCSRFFIDFPDVAEQQKKIESYLRNHFIGEEKSKYEYLMTLHGVVNQSTVCLMGYERRQTLNMITLLALKVLGEQNILPSTDNVTCFYQPAPYLVLEGGYPSYYVASGPPLVYFQPCHTVQFPVQNGMM", "length": 390, "header": "tr|D4A3M4-1|D4A3M4_RAT Isoform 1 of polynucleotide adenylyltransferase OS=Rattus norvegicus OX=10116 GN=Tent5d PE=3 SV=1 CANONICAL=D4A3M4-1" }, "isoforms": [ { "isoform_ac": "D4A3M4-1", "url": "", "sequence": { "sequence": "MSEIRFSNLTWDHIVTLDRVLDEVIPIHGRGNFPTLEVKPKDIVHVVKDQLIKQGIIVKDTRLNGSTASYILASHNGISYKDLDIIFGVDLPSDQEFQVVKDAVLGCLLDFLPKGVKKEKITLKTMKEAYVQKMVKICSNNDRWSLISLSNNTGKNVELKFVNSLRRQFEFSVDSFQILLDSMLDFYSVPNAKLTKESCPVVVAESMYGDFQEAMVHLKYKLISTRKPEEIRGGGLLKYSNLLVRDFKPACQTEIKTLERYMCSRFFIDFPDVAEQQKKIESYLRNHFIGEEKSKYEYLMTLHGVVNQSTVCLMGYERRQTLNMITLLALKVLGEQNILPSTDNVTCFYQPAPYLVLEGGYPSYYVASGPPLVYFQPCHTVQFPVQNGMM", "length": 390, "header": "tr|D4A3M4-1|D4A3M4_RAT Isoform 1 of polynucleotide adenylyltransferase OS=Rattus norvegicus OX=10116 GN=Tent5d PE=3 SV=1 CANONICAL=D4A3M4-1" }, "locus": { "chromosome": "X", "start_pos": 72968105, "end_pos": 72966936, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000108845.1", "url": "https://www.ensembl.org/id/ENSRNOT00000108845.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000089113.1", "url": "https://www.ensembl.org/id/ENSRNOP00000089113.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "rno:302368", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:302368", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "B1ATX6-1", "protein_name": "polynucleotide adenylyltransferase", "gene_name": "Tent5d", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSEIRFSNLTWDHIVTLDRVLHEVIPIHGRGNFPTLEVKPKDIIHIVKDQLIKQGIVVKDTRLNGSTASYILASHNGISYKDLDIIFGVDIPSDEEFHVVKDAVLSCLFDFLPKGVKKEKITLKTMKEAYVQKMVKICNNHDRWSLISLSNNNGKNVELKFVNSLRRQFEFSVDSFQILLDSMLDFYSVPNAKLTKESCPVVVAESMYGDFQEAMIHLKYKLISTRKPEEIRGGGLLKYSNLLVRDFKPACQTEIKTLERYMCSRFFIDFPDVAEQQKKIESYLHNHFIGEAKNKYDYLMTLHGVVNQSTVCLMGYERRQTLNMITLLALKVLGEQNILPSTDNVTCFYQPAPYLVLEGGYPSYYVASGLPLVYFQPCHTVQFPVQNGMM", "length": 390 }, "evidence": [ { "id": "45243972", "url": "http://www.informatics.jax.org/homology/45243972", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8NEK8-1", "protein_name": "Terminal nucleotidyltransferase 5D", "gene_name": "TENT5D", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSEIRFTNLTWDQVITLDQVLDEVIPIHGKGNFPTMEVKPKDIIHVVKDQLIGQGIIVKDARLNGSVASYILASHNGISYKDLDVIFGVELPGNEEFQVVKDAVLDCLLDFLPKDVKKEKLSPDIMKDAYVQKLVKVCNGHDCWSLISLSNNTGKNLELKFVSSLRRQFEFSVDSFQIVLDPMLDFYSDKNAKLTKESYPVVVAESMYGDFQEAMTHLQHKLICTRKPEEIRGGGLLKYCSLLVHGFKPACMSEIKNLERYMCSRFFIDFPHIEEQQKKIESYLHNHFIGEGMTKYDYLMTLHGVVNESTVCLMSYERRQILHLITMMALKVLGELNILPNTQKVTCFYQPAPYFAAEARYPIYVIPEPPPVSFQPYHPLHFRGSNGMS", "length": 389 }, "evidence": [ { "id": "45243972", "url": "http://www.informatics.jax.org/homology/45243972", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "mRNA stabilization", "id": "GO:0048255", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048255", "evidence": [ { "database": "UniProtKB", "id": "D4A3M4", "url": "https://www.uniprot.org/uniprot/D4A3M4" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "poly(A) RNA polymerase activity", "id": "GO:1990817", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990817", "evidence": [ { "database": "UniProtKB", "id": "D4A3M4", "url": "https://www.uniprot.org/uniprot/D4A3M4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 151, "end_pos": 153, "annotation": "n_glycosylation_sequon" }, { "start_pos": 307, "end_pos": 309, "annotation": "n_glycosylation_sequon" }, { "start_pos": 344, "end_pos": 346, "annotation": "n_glycosylation_sequon" }, { "start_pos": 64, "end_pos": 66, "annotation": "n_glycosylation_sequon" }, { "start_pos": 8, "end_pos": 10, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "11332", "name": "", "equation": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5U315-1", "Q3MHT4-1", "Q5XIV0-1", "A0A8I6G751-1", "D3ZAN6-1", "D3ZH34-1", "A0A8I6GKN3-1", "B0BNK8-1", "D4A3M4-1", "Q9NRJ5-1", "Q5VWP2-1", "Q8NEK8-1", "Q6PIY7-1", "Q5XG87-1", "P51003-1", "Q8NDF8-1", "Q9NVV4-1", "Q9BWT3-1", "Q9H6E5-1", "Q96IP4-1", "Q96A09-1", "Q5SSF7-1", "Q91YI6-1", "Q6PCL9-1", "Q9D0D3-1", "Q9WVP6-1", "Q6PB75-1", "Q61183-1", "Q68ED3-1", "Q8R3F9-1", "D3Z5S8-1", "B1ATX6-1", "Q8C152-1", "P53632-1", "P29468-1", "P48561-1", "Q54J73-1", "A0A4P7VA97-1", "O46102-1", "Q7KVS9-1", "Q9VD44-1", "Q9VYS4-1", "A0A0B4KG96-1" ], "evidence": [ { "id": "11332", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/11332" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0B4KG96", "gene_name": "hrg", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "A0A0B4KG96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4KG96" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "A0A0B4KG96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4KG96" } ] } ] }, { "uniprot_ac": "A0A4P7VA97", "gene_name": "NEST:bs36c04", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "A0A4P7VA97", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A4P7VA97" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "A0A4P7VA97", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A4P7VA97" } ] } ] }, { "uniprot_ac": "A0A8I6G751", "gene_name": "Papola", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "A0A8I6G751", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6G751" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "A0A8I6G751", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6G751" } ] } ] }, { "uniprot_ac": "A0A8I6GKN3", "gene_name": "AABR07033236.1", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "A0A8I6GKN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6GKN3" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "A0A8I6GKN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6GKN3" } ] } ] }, { "uniprot_ac": "B0BNK8", "gene_name": "Tent5b", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "B0BNK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0BNK8" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "B0BNK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0BNK8" } ] } ] }, { "uniprot_ac": "B1ATX6", "gene_name": "Tent5d", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "B1ATX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B1ATX6" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "B1ATX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B1ATX6" } ] } ] }, { "uniprot_ac": "D3Z5S8", "gene_name": "Tent5a", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "D3Z5S8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z5S8" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "D3Z5S8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z5S8" } ] } ] }, { "uniprot_ac": "D3ZAN6", "gene_name": "Papolg", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "D3ZAN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZAN6" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "D3ZAN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZAN6" } ] } ] }, { "uniprot_ac": "D3ZH34", "gene_name": "Tent5a", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "D3ZH34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZH34" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "D3ZH34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZH34" } ] } ] }, { "uniprot_ac": "D4A3M4", "gene_name": "Tent5d", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "D4A3M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A3M4" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "D4A3M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A3M4" } ] } ] }, { "uniprot_ac": "O46102", "gene_name": "MTPAP", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "O46102", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O46102" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "O46102", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O46102" } ] } ] }, { "uniprot_ac": "P29468", "gene_name": "PAP1", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "P29468", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29468" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "P29468", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29468" } ] } ] }, { "uniprot_ac": "P48561", "gene_name": "TRF5", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "P48561", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48561" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "P48561", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48561" } ] } ] }, { "uniprot_ac": "P51003", "gene_name": "PAPOLA", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "P51003", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51003" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "P51003", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51003" } ] } ] }, { "uniprot_ac": "P53632", "gene_name": "PAP2", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "P53632", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53632" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "P53632", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53632" } ] } ] }, { "uniprot_ac": "Q3MHT4", "gene_name": "Tut1", "activity": [ { "ec_number": "2.7.7.52", "activity": "RNA(n) + UTP = diphosphate + RNA(n)-3'-uridine ribonucleotide.", "evidence": [ { "id": "Q3MHT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MHT4" } ] }, { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q3MHT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MHT4" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q3MHT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MHT4" } ] } ] }, { "uniprot_ac": "Q54J73", "gene_name": "papA", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q54J73", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54J73" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q54J73", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54J73" } ] } ] }, { "uniprot_ac": "Q5SSF7", "gene_name": "Tent5c", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q5SSF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SSF7" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q5SSF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SSF7" } ] } ] }, { "uniprot_ac": "Q5U315", "gene_name": "Tent2", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q5U315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U315" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q5U315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U315" } ] } ] }, { "uniprot_ac": "Q5VWP2", "gene_name": "TENT5C", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q5VWP2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VWP2" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q5VWP2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VWP2" } ] } ] }, { "uniprot_ac": "Q5XG87", "gene_name": "TENT4A", "activity": [ { "ec_number": "2.7.7.-", "activity": "", "evidence": [ { "id": "Q5XG87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XG87" } ] }, { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q5XG87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XG87" } ] } ] }, { "uniprot_ac": "Q5XIV0", "gene_name": "Tent5c", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q5XIV0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIV0" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q5XIV0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIV0" } ] } ] }, { "uniprot_ac": "Q61183", "gene_name": "Papola", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q61183", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61183" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q61183", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61183" } ] } ] }, { "uniprot_ac": "Q68ED3", "gene_name": "Tent4b", "activity": [ { "ec_number": "2.7.7.-", "activity": "", "evidence": [ { "id": "Q68ED3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68ED3" } ] }, { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q68ED3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68ED3" } ] } ] }, { "uniprot_ac": "Q6PB75", "gene_name": "Tent4a", "activity": [ { "ec_number": "2.7.7.-", "activity": "", "evidence": [ { "id": "Q6PB75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PB75" } ] }, { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q6PB75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PB75" } ] } ] }, { "uniprot_ac": "Q6PCL9", "gene_name": "Papolg", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q6PCL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PCL9" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q6PCL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PCL9" } ] } ] }, { "uniprot_ac": "Q6PIY7", "gene_name": "TENT2", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q6PIY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PIY7" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q6PIY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PIY7" } ] } ] }, { "uniprot_ac": "Q7KVS9", "gene_name": "Trf4-1", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q7KVS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KVS9" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q7KVS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KVS9" } ] } ] }, { "uniprot_ac": "Q8C152", "gene_name": "Tent5b", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q8C152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C152" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q8C152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C152" } ] } ] }, { "uniprot_ac": "Q8NDF8", "gene_name": "TENT4B", "activity": [ { "ec_number": "2.7.7.-", "activity": "", "evidence": [ { "id": "Q8NDF8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NDF8" } ] }, { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q8NDF8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NDF8" } ] } ] }, { "uniprot_ac": "Q8NEK8", "gene_name": "TENT5D", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q8NEK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEK8" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q8NEK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEK8" } ] } ] }, { "uniprot_ac": "Q8R3F9", "gene_name": "Tut1", "activity": [ { "ec_number": "2.7.7.52", "activity": "RNA(n) + UTP = diphosphate + RNA(n)-3'-uridine ribonucleotide.", "evidence": [ { "id": "Q8R3F9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R3F9" } ] }, { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q8R3F9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R3F9" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q8R3F9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R3F9" } ] } ] }, { "uniprot_ac": "Q91YI6", "gene_name": "Tent2", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q91YI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YI6" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q91YI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YI6" } ] } ] }, { "uniprot_ac": "Q96A09", "gene_name": "TENT5B", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q96A09", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96A09" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q96A09", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96A09" } ] } ] }, { "uniprot_ac": "Q96IP4", "gene_name": "TENT5A", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q96IP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96IP4" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q96IP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96IP4" } ] } ] }, { "uniprot_ac": "Q9BWT3", "gene_name": "PAPOLG", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q9BWT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BWT3" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q9BWT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BWT3" } ] } ] }, { "uniprot_ac": "Q9D0D3", "gene_name": "Mtpap", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q9D0D3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D0D3" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q9D0D3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D0D3" } ] } ] }, { "uniprot_ac": "Q9H6E5", "gene_name": "TUT1", "activity": [ { "ec_number": "2.7.7.52", "activity": "RNA(n) + UTP = diphosphate + RNA(n)-3'-uridine ribonucleotide.", "evidence": [ { "id": "Q9H6E5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H6E5" } ] }, { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q9H6E5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H6E5" } ] }, { "ec_number": "2.7.7.52", "activity": "", "evidence": [ { "id": "Q9H6E5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H6E5" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q9H6E5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H6E5" } ] } ] }, { "uniprot_ac": "Q9NRJ5", "gene_name": "PAPOLB", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q9NRJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRJ5" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q9NRJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRJ5" } ] } ] }, { "uniprot_ac": "Q9NVV4", "gene_name": "MTPAP", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q9NVV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NVV4" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q9NVV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NVV4" } ] } ] }, { "uniprot_ac": "Q9VD44", "gene_name": "Gld2", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q9VD44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VD44" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q9VD44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VD44" } ] } ] }, { "uniprot_ac": "Q9VYS4", "gene_name": "wisp", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q9VYS4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VYS4" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q9VYS4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VYS4" } ] } ] }, { "uniprot_ac": "Q9WVP6", "gene_name": "Papolb", "activity": [ { "ec_number": "2.7.7.19", "activity": "ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide.", "evidence": [ { "id": "Q9WVP6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVP6" } ] }, { "ec_number": "2.7.7.19", "activity": "", "evidence": [ { "id": "Q9WVP6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVP6" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }