{ "uniprot_canonical_ac": "D4A265-1", "uniprot_ac": "D4A265", "uniprot_id": "D4A265_RAT", "mass": { "chemical_mass": 15060.0, "monoisotopic_mass": 15060.0 }, "refseq": { "ac": "NP_001099927", "name": "helix-loop-helix protein 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099927" }, "gene_names": [ { "name": "Nhlh2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D4A265", "id": "D4A265" }, { "name": "Nhlh2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099927", "id": "NP_001099927" } ], "protein_names": [ { "name": "Nescient helix loop helix 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D4A265" }, { "name": "helix-loop-helix protein 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099927", "id": "NP_001099927" } ], "function": [], "disease": [ { "disease_id": "DOID:0090070", "recommended_name": { "id": "DOID:0090070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0090070", "name": "hypogonadotropic hypogonadism", "description": "A hypogonadism characterized by a impaired signalling by gonadotrpin relasing hormone." }, "synonyms": [ { "id": "DOID:0090070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0090070", "name": "hypogonadotropism", "description": "" }, { "id": "DOID:0090070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0090070", "name": "congenital idiopathic hypogonadotropic hypogonadism", "description": "" }, { "id": "DOID:0090070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0090070", "name": "isolated congenital gonadotropin deficiency", "description": "" }, { "id": "MONDO:0007844", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007844", "name": "hypogonadotropic hypogonadism 2 with or without anosmia", "description": "Any hypogonadotropic hypogonadism in which the cause of the disease is a mutation in the FGFR1 gene." }, { "id": "MONDO:0007844", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007844", "name": "FGFR1 hypogonadotropic hypogonadism", "description": "" }, { "id": "MONDO:0007844", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007844", "name": "hypogonadotropic hypogonadism 2 with or without anosmia", "description": "" }, { "id": "MONDO:0007844", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007844", "name": "hypogonadotropic hypogonadism caused by mutation in FGFR1", "description": "" }, { "id": "MONDO:0007844", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007844", "name": "HH2", "description": "" }, { "id": "MONDO:0007844", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007844", "name": "KAL2", "description": "" }, { "id": "MONDO:0007844", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007844", "name": "Kallmann syndrome 2", "description": "" }, { "id": "MIM:147950", "resource": "MIM", "url": "https://www.omim.org/entry/147950", "name": "Hypogonadotropic hypogonadism 2 with or without anosmia", "description": "Hypogonadotropic hypogonadism 2 with or without anosmia" } ], "evidence": [ { "id": "0090070", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0090070" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D4A265", "url": "https://www.uniprot.org/uniprot/D4A265" } ], "common_name": "Rat" } ], "gene": [ { "name": "Nhlh2", "url": "https://www.uniprot.org/uniprot/D4A265", "locus": { "chromosome": "2", "start_pos": 189449625, "end_pos": 189442711, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000054375", "url": "https://www.ensembl.org/id/ENSRNOG00000054375" } ] } } ], "crossref": [ { "id": "ENSRNOG00000054375", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000054375", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd19702", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd19702", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "295327", "url": "https://www.ncbi.nlm.nih.gov/gene/295327", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR011598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036638", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036638", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040238", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040238", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:295327", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:295327", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "CASDPEP", "url": "https://omabrowser.org/oma/group/CASDPEP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5403650at2759", "url": "http://www.orthodb.org/?query=5403650at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13864", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13864", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13864:SF19", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13864:SF19", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00010", "url": "http://pfam.xfam.org/family/PF00010", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001099927", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099927", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1308294", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1308294", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "D4A265", "url": "https://www.uniprot.org/uniprot/D4A265", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4A265-1", "url": "https://www.uniprot.org/uniprot/D4A265-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMLSPDQAADSDHPSSTHSDPESLGGVDTKVLGSVSDLEPVEEVDGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV", "length": 135, "header": "tr|D4A265-1|D4A265_RAT Isoform 1 of Nescient helix loop helix 2 OS=Rattus norvegicus OX=10116 GN=Nhlh2 PE=4 SV=1 CANONICAL=D4A265-1" }, "isoforms": [ { "isoform_ac": "D4A265-1", "url": "", "sequence": { "sequence": "MMLSPDQAADSDHPSSTHSDPESLGGVDTKVLGSVSDLEPVEEVDGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV", "length": 135, "header": "tr|D4A265-1|D4A265_RAT Isoform 1 of Nescient helix loop helix 2 OS=Rattus norvegicus OX=10116 GN=Nhlh2 PE=4 SV=1 CANONICAL=D4A265-1" }, "locus": { "chromosome": "2", "start_pos": 189447192, "end_pos": 189446788, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000101630.1", "url": "https://www.ensembl.org/id/ENSRNOT00000101630.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000097496.1", "url": "https://www.ensembl.org/id/ENSRNOP00000097496.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:295327", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:295327", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q02577-1", "protein_name": "Helix-loop-helix protein 2", "gene_name": "NHLH2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV", "length": 135 }, "evidence": [ { "id": "45232291", "url": "http://www.informatics.jax.org/homology/45232291", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q64221-1", "protein_name": "Helix-loop-helix protein 2", "gene_name": "Nhlh2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MMLSPDQAADSDHPSSTHSDPESLGGADTKVLGSVSDLEPVEEADGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV", "length": 135 }, "evidence": [ { "id": "45232291", "url": "http://www.informatics.jax.org/homology/45232291", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 9, "go_terms": [ { "name": "male mating behavior", "id": "GO:0060179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060179", "evidence": [ { "database": "UniProtKB", "id": "D4A265", "url": "https://www.uniprot.org/uniprot/D4A265" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "D4A265", "url": "https://www.uniprot.org/uniprot/D4A265" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "D4A265", "url": "https://www.uniprot.org/uniprot/D4A265" } ], "pmid": "" }, { "name": "apoptotic process", "id": "GO:0006915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006915", "evidence": [ { "database": "UniProtKB", "id": "D4A265", "url": "https://www.uniprot.org/uniprot/D4A265" } ], "pmid": "" }, { "name": "male gonad development", "id": "GO:0008584", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008584", "evidence": [ { "database": "UniProtKB", "id": "D4A265", "url": "https://www.uniprot.org/uniprot/D4A265" } ], "pmid": "" }, { "name": "peripheral nervous system development", "id": "GO:0007422", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007422", "evidence": [ { "database": "UniProtKB", "id": "D4A265", "url": "https://www.uniprot.org/uniprot/D4A265" } ], "pmid": "" }, { "name": "cell migration in hindbrain", "id": "GO:0021535", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021535", "evidence": [ { "database": "UniProtKB", "id": "D4A265", "url": "https://www.uniprot.org/uniprot/D4A265" } ], "pmid": "" }, { "name": "ovulation cycle", "id": "GO:0042698", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042698", "evidence": [ { "database": "UniProtKB", "id": "D4A265", "url": "https://www.uniprot.org/uniprot/D4A265" } ], "pmid": "" }, { "name": "hypothalamus gonadotrophin-releasing hormone neuron development", "id": "GO:0021888", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021888", "evidence": [ { "database": "UniProtKB", "id": "D4A265", "url": "https://www.uniprot.org/uniprot/D4A265" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 7, "go_terms": [ { "name": "protein dimerization activity", "id": "GO:0046983", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046983", "evidence": [ { "database": "UniProtKB", "id": "D4A265", "url": "https://www.uniprot.org/uniprot/D4A265" } ], "pmid": "" }, { "name": "RNA polymerase II transcription regulatory region sequence-specific DNA binding", "id": "GO:0000977", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000977", "evidence": [ { "database": "UniProtKB", "id": "D4A265", "url": "https://www.uniprot.org/uniprot/D4A265" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "D4A265", "url": "https://www.uniprot.org/uniprot/D4A265" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "D4A265", "url": "https://www.uniprot.org/uniprot/D4A265" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "D4A265", "url": "https://www.uniprot.org/uniprot/D4A265" } ], "pmid": "" }, { "name": "RNA polymerase II-specific DNA-binding transcription factor binding", "id": "GO:0061629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061629", "evidence": [ { "database": "UniProtKB", "id": "D4A265", "url": "https://www.uniprot.org/uniprot/D4A265" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "D4A265", "url": "https://www.uniprot.org/uniprot/D4A265" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "D4A265", "url": "https://www.uniprot.org/uniprot/D4A265" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }