{ "uniprot_canonical_ac": "D3ZY56-1", "uniprot_ac": "D3ZY56", "uniprot_id": "D3ZY56_RAT", "mass": { "chemical_mass": 17865.0, "monoisotopic_mass": 17865.0 }, "refseq": {}, "gene_names": [ { "name": "RGD1564854", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D3ZY56", "id": "D3ZY56" } ], "protein_names": [ { "name": "Similar to divalent cation tolerant protein CUTA", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D3ZY56" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D3ZY56", "url": "https://www.uniprot.org/uniprot/D3ZY56" } ], "common_name": "Rat" } ], "gene": [ { "name": "RGD1564854", "url": "https://www.uniprot.org/uniprot/D3ZY56", "locus": { "chromosome": "3", "start_pos": 18173796, "end_pos": 18154300, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000018832", "url": "https://www.ensembl.org/id/ENSRNOG00000018832" } ] } } ], "crossref": [ { "id": "ENSRNOG00000018832", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000018832", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "502617", "url": "https://www.ncbi.nlm.nih.gov/gene/502617", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR004323", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004323", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011322", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011322", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015867", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015867", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:502617", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:502617", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "DVQYLKW", "url": "https://omabrowser.org/oma/group/DVQYLKW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4009021at2759", "url": "http://www.orthodb.org/?query=4009021at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23419", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23419", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23419:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23419:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03091", "url": "http://pfam.xfam.org/family/PF03091", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001102811", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102811", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1564854", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1564854", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I6ANK7", "url": "https://www.uniprot.org/uniprot/A0A8I6ANK7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6ANK7-1", "url": "https://www.uniprot.org/uniprot/A0A8I6ANK7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZY56", "url": "https://www.uniprot.org/uniprot/D3ZY56", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZY56-1", "url": "https://www.uniprot.org/uniprot/D3ZY56-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDRPESRCPPPGLLRLPVLTCLLILTAVLTYPMLRTLSLWLHSSLTGSYVSGSYSIVFVNCPNEQIARDIARTILDKKMAASVNILPKISTLYFWKGEIEEGTEVSLLIKTKTSKVPWLFAYMRLTHPFEVPEIFSIPMDQGDTRYLKWLEEGMKAN", "length": 157, "header": "tr|D3ZY56-1|D3ZY56_RAT Isoform 1 of Similar to divalent cation tolerant protein CUTA OS=Rattus norvegicus OX=10116 GN=RGD1564854 PE=3 SV=1 CANONICAL=D3ZY56-1" }, "isoforms": [ { "isoform_ac": "A0A8I6ANK7-1", "url": "", "sequence": { "sequence": "MDRPESRCPPPGLLRLPVLTCLLILTAVLTYPMLRTLSLWLHSSLTGSYVSGSYSIVFVNCPNEQIARDIARTILDKKMAASVNILPKISTLYFWKGEIEEGTEVSLVDASF", "length": 112, "header": "tr|A0A8I6ANK7-1|D3ZY56_RAT Computationally mapped isoform of Similar to divalent cation tolerant protein CUTA OS=Rattus norvegicus OX=10116 GN=RGD1564854 PE=3 SV=1 CANONICAL=D3ZY56-1" }, "locus": { "chromosome": "3", "start_pos": 18171929, "end_pos": 18154359, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000102877.1", "url": "https://www.ensembl.org/id/ENSRNOT00000102877.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000094648.1", "url": "https://www.ensembl.org/id/ENSRNOP00000094648.1" } ] } }, { "isoform_ac": "D3ZY56-1", "url": "", "sequence": { "sequence": "MDRPESRCPPPGLLRLPVLTCLLILTAVLTYPMLRTLSLWLHSSLTGSYVSGSYSIVFVNCPNEQIARDIARTILDKKMAASVNILPKISTLYFWKGEIEEGTEVSLLIKTKTSKVPWLFAYMRLTHPFEVPEIFSIPMDQGDTRYLKWLEEGMKAN", "length": 157, "header": "tr|D3ZY56-1|D3ZY56_RAT Isoform 1 of Similar to divalent cation tolerant protein CUTA OS=Rattus norvegicus OX=10116 GN=RGD1564854 PE=3 SV=1 CANONICAL=D3ZY56-1" }, "locus": { "chromosome": "3", "start_pos": 18172014, "end_pos": 18154359, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000025501.5", "url": "https://www.ensembl.org/id/ENSRNOT00000025501.5" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000025501.4", "url": "https://www.ensembl.org/id/ENSRNOP00000025501.4" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:502617", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:502617", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9D1U5-1", "protein_name": "CutA divalent cation tolerance homolog-like", "gene_name": "Cutal", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDRPESRCPPPGSLRLVLTCLLILTAVLMYPVLRTFSLWLHSSLTGIYVSGSYSIVFVNCPNEQIARDIARAILDKKMASSVNILPKTSSLYFWKGEIEEGIEVSLLIKTKTSKVSRLFAYMRLAHPFEIPEVFSIPMDQGDARFLRWLEEGMKEN", "length": 156 }, "evidence": [ { "id": "45236427", "url": "http://www.informatics.jax.org/homology/45236427", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "copper ion binding", "id": "GO:0005507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005507", "evidence": [ { "database": "UniProtKB", "id": "D3ZY56", "url": "https://www.uniprot.org/uniprot/D3ZY56" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "response to metal ion", "id": "GO:0010038", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010038", "evidence": [ { "database": "UniProtKB", "id": "D3ZY56", "url": "https://www.uniprot.org/uniprot/D3ZY56" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }