{ "uniprot_canonical_ac": "D3ZWB7-1", "uniprot_ac": "D3ZWB7", "uniprot_id": "D3ZWB7_RAT", "mass": { "chemical_mass": 52045.0, "monoisotopic_mass": 52045.0 }, "refseq": { "ac": "NP_001101704", "name": "sialidase-4", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101704" }, "gene_names": [ { "name": "Neu4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D3ZWB7", "id": "D3ZWB7" }, { "name": "Neu4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101704", "id": "NP_001101704" } ], "protein_names": [ { "name": "exo-alpha-sialidase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "D3ZWB7" }, { "name": "3.2.1.18", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D3ZWB7" }, { "name": "sialidase-4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101704", "id": "NP_001101704" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D3ZWB7", "url": "https://www.uniprot.org/uniprot/D3ZWB7" } ], "common_name": "Rat" } ], "gene": [ { "name": "Neu4", "url": "https://www.uniprot.org/uniprot/D3ZWB7", "locus": { "chromosome": "9", "start_pos": 94402576, "end_pos": 94396920, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000019031", "url": "https://www.ensembl.org/id/ENSRNOG00000019031" } ] } } ], "crossref": [ { "id": "ENSRNOG00000019031", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000019031", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd15482", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15482", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "316642", "url": "https://www.ncbi.nlm.nih.gov/gene/316642", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR011040", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011040", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR026856", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026856", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036278", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036278", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:316642", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:316642", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "LRDWATF", "url": "https://omabrowser.org/oma/group/LRDWATF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5482010at2759", "url": "http://www.orthodb.org/?query=5482010at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10628", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10628", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10628:SF22", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10628:SF22", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13088", "url": "http://pfam.xfam.org/family/PF13088", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-4085001", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-4085001", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9840310", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001101704", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101704", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1308624", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1308624", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "D3ZWB7", "url": "https://www.uniprot.org/uniprot/D3ZWB7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZWB7-1", "url": "https://www.uniprot.org/uniprot/D3ZWB7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGPAHVPKRTVLFQRERTGLTYRVPALLCVPPRPTLLAFAEQRLSPDDSHAHRLVLRRGTLTRGSVRWGVLSVLETAVLEEHRSMNPCPVLDEHSGTIFLFFIAVRGHTPEAVQIATGKNAARLCCVTSCDAGLTWGSVRDLTEEAIGAALQDWATFAVGPGHGVQLRSGRLLVPAYTYHVDRRECFGRICWTSPHSLAFYSDDHGISWHCGGLVPNLRSGECQLAAVDGDFLYCNARSPLGNRVQALSADEGTSFLPGELVPTLAETARGCQGSIVGFPAPPSIGPQDDRWLASPGNTPHSPCFDLRVRESLAEGARGFVEGWASRLLLCYPQSRGPENHGLEPGPDGEKTSWSPELPMSSASVRQSSTWLLYSHPAGRRARLHMGIYLSRSPLDPHSWTEPWIIYEGPSGYSDLAFLGPVPGASLAFACLFESGTRASYEDISFCLFSLADVLENVPTGLEISSLRNKPQGHCWPS", "length": 478, "header": "tr|D3ZWB7-1|D3ZWB7_RAT Isoform 1 of exo-alpha-sialidase OS=Rattus norvegicus OX=10116 GN=Neu4 PE=3 SV=1 CANONICAL=D3ZWB7-1" }, "isoforms": [ { "isoform_ac": "D3ZWB7-1", "url": "", "sequence": { "sequence": "MGPAHVPKRTVLFQRERTGLTYRVPALLCVPPRPTLLAFAEQRLSPDDSHAHRLVLRRGTLTRGSVRWGVLSVLETAVLEEHRSMNPCPVLDEHSGTIFLFFIAVRGHTPEAVQIATGKNAARLCCVTSCDAGLTWGSVRDLTEEAIGAALQDWATFAVGPGHGVQLRSGRLLVPAYTYHVDRRECFGRICWTSPHSLAFYSDDHGISWHCGGLVPNLRSGECQLAAVDGDFLYCNARSPLGNRVQALSADEGTSFLPGELVPTLAETARGCQGSIVGFPAPPSIGPQDDRWLASPGNTPHSPCFDLRVRESLAEGARGFVEGWASRLLLCYPQSRGPENHGLEPGPDGEKTSWSPELPMSSASVRQSSTWLLYSHPAGRRARLHMGIYLSRSPLDPHSWTEPWIIYEGPSGYSDLAFLGPVPGASLAFACLFESGTRASYEDISFCLFSLADVLENVPTGLEISSLRNKPQGHCWPS", "length": 478, "header": "tr|D3ZWB7-1|D3ZWB7_RAT Isoform 1 of exo-alpha-sialidase OS=Rattus norvegicus OX=10116 GN=Neu4 PE=3 SV=1 CANONICAL=D3ZWB7-1" }, "locus": { "chromosome": "9", "start_pos": 94401637, "end_pos": 94398552, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000065533.3", "url": "https://www.ensembl.org/id/ENSRNOT00000065533.3" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000063883.1", "url": "https://www.ensembl.org/id/ENSRNOP00000063883.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "rno:316642", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:316642", "resource": "KEGG Pathway" }, { "id": "R-RNO-4085001", "name": "Sialic acid metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-4085001", "resource": "Reactome", "description": "Sialic acid metabolism" }, { "id": "R-RNO-9840310", "name": "Glycosphingolipid catabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9840310", "resource": "Reactome", "description": "Glycosphingolipid catabolism" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8BZL1-2", "protein_name": "Sialidase-4", "gene_name": "Neu4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGPTRVPRRTVLFQRERTGLTYRVPALLCVPPRPTLLAFAEQRLSPDDSHAHRLVLRRGTLTRGSVRWGTLSVLETAVLEEHRSMNPCPVLDEHSGTIFLFFIAVLGHTPEAVQIATGKNAARLCCVTSCDAGLTWGSVRDLTEEAIGAALQDWATFAVGPGHGVQLRSGRLLVPAYTYHVDRRECFGKICWTSPHSLAFYSDDHGISWHCGGLVPNLRSGECQLAAVDGDFLYCNARSPLGNRVQALSADEGTSFLPGELVPTLAETARGCQGSIVGFLAPPSIEPQDDRWTGSPRNTPHSPCFNLRVQESSGEGARGLLERWMPRLPLCYPQSRSPENHGLEPGSDGDKTSWTPECPMSSDSMLQSPTWLLYSHPAGRRARLHMGIYLSRSPLDPHSWTEPWVIYEGPSGYSDLAFLGPMPGASLVFACLFESGTRTSYEDISFCLFSLADVLENVPTGLEMLSLRDKAQGHCWPS", "length": 478 }, "evidence": [ { "id": "45229295", "url": "http://www.informatics.jax.org/homology/45229295", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8WWR8-1", "protein_name": "Sialidase-4", "gene_name": "NEU4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPDDSHAHRLVLRRGTLAGGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQLPSGRLLVPAYTYRVDRRECFGKICRTSPHSFAFYSDDHGRTWRCGGLVPNLRSGECQLAAVDGGQAGSFLYCNARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPAPNRPRDDSWSVGPGSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQPRGDGPRQPGPRPGVSGDVGSWTLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTEPWVIYEGPSGYSDLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPRGCCWPS", "length": 484 }, "evidence": [ { "id": "45229295", "url": "http://www.informatics.jax.org/homology/45229295", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "ganglioside catabolic process", "id": "GO:0006689", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006689", "evidence": [ { "database": "UniProtKB", "id": "D3ZWB7", "url": "https://www.uniprot.org/uniprot/D3ZWB7" } ], "pmid": "" }, { "name": "negative regulation of neuron projection development", "id": "GO:0010977", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010977", "evidence": [ { "database": "UniProtKB", "id": "D3ZWB7", "url": "https://www.uniprot.org/uniprot/D3ZWB7" } ], "pmid": "" }, { "name": "oligosaccharide catabolic process", "id": "GO:0009313", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009313", "evidence": [ { "database": "UniProtKB", "id": "D3ZWB7", "url": "https://www.uniprot.org/uniprot/D3ZWB7" } ], "pmid": "" }, { "name": "glycoprotein catabolic process", "id": "GO:0006516", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006516", "evidence": [ { "database": "UniProtKB", "id": "D3ZWB7", "url": "https://www.uniprot.org/uniprot/D3ZWB7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "organelle inner membrane", "id": "GO:0019866", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019866", "evidence": [ { "database": "UniProtKB", "id": "D3ZWB7", "url": "https://www.uniprot.org/uniprot/D3ZWB7" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "D3ZWB7", "url": "https://www.uniprot.org/uniprot/D3ZWB7" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "D3ZWB7", "url": "https://www.uniprot.org/uniprot/D3ZWB7" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "D3ZWB7", "url": "https://www.uniprot.org/uniprot/D3ZWB7" } ], "pmid": "" }, { "name": "lysosome", "id": "GO:0005764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005764", "evidence": [ { "database": "UniProtKB", "id": "D3ZWB7", "url": "https://www.uniprot.org/uniprot/D3ZWB7" } ], "pmid": "" }, { "name": "neuron projection", "id": "GO:0043005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043005", "evidence": [ { "database": "UniProtKB", "id": "D3ZWB7", "url": "https://www.uniprot.org/uniprot/D3ZWB7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "exo-alpha-(2->3)-sialidase activity", "id": "GO:0052794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052794", "evidence": [ { "database": "UniProtKB", "id": "D3ZWB7", "url": "https://www.uniprot.org/uniprot/D3ZWB7" } ], "pmid": "" }, { "name": "exo-alpha-(2->6)-sialidase activity", "id": "GO:0052795", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052795", "evidence": [ { "database": "UniProtKB", "id": "D3ZWB7", "url": "https://www.uniprot.org/uniprot/D3ZWB7" } ], "pmid": "" }, { "name": "exo-alpha-(2->8)-sialidase activity", "id": "GO:0052796", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052796", "evidence": [ { "database": "UniProtKB", "id": "D3ZWB7", "url": "https://www.uniprot.org/uniprot/D3ZWB7" } ], "pmid": "" }, { "name": "exo-alpha-sialidase activity", "id": "GO:0004308", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004308", "evidence": [ { "database": "UniProtKB", "id": "D3ZWB7", "url": "https://www.uniprot.org/uniprot/D3ZWB7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-RNO-1605724", "name": "NEU1,4 hydrolyze PSAP(195-273):GM3:PE", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "lysosomal lumen", "input_participant_list": [], "output_participant_list": [ "R-ALL-428639" ], "enzyme_list": [ "D3ZWB7-1", "D3ZUM4-1", "Q99PW3-1" ], "evidence": [ { "id": "R-RNO-1605724", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1605724" } ] }, { "id": "R-RNO-9638120", "name": "NEU4 hydrolyses Neu5Ac from glycoconjugates", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "lysosomal lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D3ZWB7-1", "D3ZUM4-1" ], "evidence": [ { "id": "R-RNO-9638120", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9638120" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-428639", "participant_name": "Neu5Ac [lysosomal lumen]", "crossref": [ { "id": "000004081651", "database": "ZINC", "url": "" }, { "id": "35418", "database": "ChEBI", "url": "" }, { "id": "000003793840", "database": "ZINC", "url": "" }, { "id": "000004081651", "database": "ZINC", "url": "" }, { "id": "35418", "database": "ChEBI", "url": "" }, { "id": "000003793840", "database": "ZINC", "url": "" }, { "id": "35418", "database": "ChEBI", "url": "" }, { "id": "000003793840", "database": "ZINC", "url": "" }, { "id": "000004081651", "database": "ZINC", "url": "" }, { "id": "35418", "database": "ChEBI", "url": "" }, { "id": "000003793840", "database": "ZINC", "url": "" }, { "id": "000004081651", "database": "ZINC", "url": "" }, { "id": "35418", "database": "ChEBI", "url": "" }, { "id": "000003793840", "database": "ZINC", "url": "" }, { "id": "000004081651", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "D3ZUM4", "gene_name": "Glb1", "activity": [ { "ec_number": "3.2.1.23", "activity": "Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides.", "evidence": [ { "id": "D3ZUM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZUM4" } ] }, { "ec_number": "3.2.1.23", "activity": "", "evidence": [ { "id": "D3ZUM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZUM4" } ] } ] }, { "uniprot_ac": "D3ZWB7", "gene_name": "Neu4", "activity": [ { "ec_number": "3.2.1.18", "activity": "Hydrolysis of alpha-(2->3)-, alpha-(2->6)-, alpha-(2->8)- glycosidic linkages of terminal sialic acid residues in oligosaccharides, glycoproteins, glycolipids, colominic acid and synthetic substrates.", "evidence": [ { "id": "D3ZWB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZWB7" } ] }, { "ec_number": "3.2.1.18", "activity": "", "evidence": [ { "id": "D3ZWB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZWB7" } ] } ] }, { "uniprot_ac": "Q99PW3", "gene_name": "Neu1", "activity": [ { "ec_number": "3.2.1.18", "activity": "Hydrolysis of alpha-(2->3)-, alpha-(2->6)-, alpha-(2->8)- glycosidic linkages of terminal sialic acid residues in oligosaccharides, glycoproteins, glycolipids, colominic acid and synthetic substrates.", "evidence": [ { "id": "Q99PW3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PW3" } ] }, { "ec_number": "3.2.1.18", "activity": "", "evidence": [ { "id": "Q99PW3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PW3" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }