{ "uniprot_canonical_ac": "D3ZVU9-1", "uniprot_ac": "D3ZVU9", "uniprot_id": "NAT8L_RAT", "mass": { "chemical_mass": 32719.0, "monoisotopic_mass": 32719.0 }, "refseq": { "ac": "NP_001178610", "name": "N-acetylaspartate synthetase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178610" }, "gene_names": [ { "name": "Nat8l", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D3ZVU9", "id": "D3ZVU9" }, { "name": "Nat8l", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178610", "id": "NP_001178610" }, { "name": "RGD1305719", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178610", "id": "NP_001178610" } ], "protein_names": [ { "name": "N-acetylaspartate synthetase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "D3ZVU9" }, { "name": "2.3.1.17", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D3ZVU9" }, { "name": "N-acetylaspartate synthetase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178610", "id": "NP_001178610" }, { "name": "N-acetyltransferase 8-like protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D3ZVU9" }, { "name": "NAA synthetase; N-acetyltransferase 8-like protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178610", "id": "NP_001178610" }, { "name": "NAA synthetase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D3ZVU9" } ], "function": [ { "annotation": "Asp-NAT/NAT8L and NAA immunoreactivities correlate very well in rat brain, with primary localization in neurons, including cortical pyramidal neurons and granule cells of the hippocampus.", "evidence": [ { "database": "RefSeq", "id": "NP_001178610", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178610" }, { "database": "PubMed", "id": "20385109", "url": "https://glygen.org/publication/PubMed/20385109" } ] }, { "annotation": "Catalyzes the synthesis of N-acetylaspartate acid (NAA) from L-aspartate and acetyl-CoA (PubMed:18621030). Promotes dopamine uptake by regulating TNF-alpha expression (By similarity). Attenuates methamphetamine-induced inhibition of dopamine uptake (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "D3ZVU9", "url": "https://www.uniprot.org/uniprot/D3ZVU9#function" }, { "database": "PubMed", "id": "18621030", "url": "https://glygen.org/publication/PubMed/18621030" }, { "database": "UniProtKB", "id": "Q3UGX3", "url": "https://www.uniprot.org/uniprot/Q3UGX3#function" }, { "database": "UniProtKB", "id": "Q8N9F0", "url": "https://www.uniprot.org/uniprot/Q8N9F0#function" } ] }, { "annotation": "The decrease in N-acetylaspartate following severe traumatic brain injury was characterized by profound mitochondrial malfunctioning, dramatic repression of Nat8l gene and concomitant increase in the ASPA gene and protein levels. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001178610", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178610" }, { "database": "PubMed", "id": "24515258", "url": "https://glygen.org/publication/PubMed/24515258" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D3ZVU9", "url": "https://www.uniprot.org/uniprot/D3ZVU9" } ], "common_name": "Rat" } ], "gene": [ { "name": "Nat8l", "url": "https://www.uniprot.org/uniprot/D3ZVU9", "locus": { "chromosome": "14", "start_pos": 76756077, "end_pos": 76763411, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000049351", "url": "https://www.ensembl.org/id/ENSRNOG00000049351" } ] } } ], "crossref": [ { "id": "ENSRNOG00000049351", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000049351", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd04301", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04301", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "289727", "url": "https://www.ncbi.nlm.nih.gov/gene/289727", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000182", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000182", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016181", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016181", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:289727", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:289727", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "FHEGIME", "url": "https://omabrowser.org/oma/group/FHEGIME/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5358579at2759", "url": "http://www.orthodb.org/?query=5358579at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13947", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13947", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13947:SF11", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13947:SF11", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00583", "url": "http://pfam.xfam.org/family/PF00583", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_D3ZVU9", "url": "http://purl.obolibrary.org/obo/PR_D3ZVU9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-8963693", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8963693", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001178610", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178610", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1305719", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1305719", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "14165", "url": "https://www.rhea-db.org/rhea/14165", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "D3ZVU9", "url": "https://www.uniprot.org/uniprot/D3ZVU9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZVU9-1", "url": "https://www.uniprot.org/uniprot/D3ZVU9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MHCGPPDMVCETKIVATEDHEALPGAKKDALLAAAGAMWPPLPAAPGPAAAPPPAAGPQPHGGTGGAGPPEGRGVCIREFRAAEQEAARRIFYDGILERIPNTAFRGLRQHPRTQLLYALLAALCFAVTRSLLLTCLVPAGLLALRYYYSRKVILAYLECALHTDMADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRRVLEFAMLHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE", "length": 299, "header": "sp|D3ZVU9-1|NAT8L_RAT Isoform 1 of N-acetylaspartate synthetase OS=Rattus norvegicus OX=10116 GN=Nat8l PE=1 SV=1 CANONICAL=D3ZVU9-1" }, "isoforms": [ { "isoform_ac": "D3ZVU9-1", "url": "", "sequence": { "sequence": "MHCGPPDMVCETKIVATEDHEALPGAKKDALLAAAGAMWPPLPAAPGPAAAPPPAAGPQPHGGTGGAGPPEGRGVCIREFRAAEQEAARRIFYDGILERIPNTAFRGLRQHPRTQLLYALLAALCFAVTRSLLLTCLVPAGLLALRYYYSRKVILAYLECALHTDMADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRRVLEFAMLHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE", "length": 299, "header": "sp|D3ZVU9-1|NAT8L_RAT Isoform 1 of N-acetylaspartate synthetase OS=Rattus norvegicus OX=10116 GN=Nat8l PE=1 SV=1 CANONICAL=D3ZVU9-1" }, "locus": { "chromosome": "14", "start_pos": 76762712, "end_pos": 76758459, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000074734", "url": "https://www.ensembl.org/id/ENSRNOT00000074734" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000066413", "url": "https://www.ensembl.org/id/ENSRNOP00000066413" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "N-acetylaspartate synthesis in the brain: mitochondria vs. microsomes.", "journal": "Brain Res.", "date": "2008", "authors": "Ariyannur P.S., Madhavarao C.N., Namboodiri A.M.", "evidence": [ { "database": "UniProtKB", "id": "D3ZVU9", "url": "https://www.uniprot.org/uniprot/D3ZVU9" } ], "reference": [ { "type": "PubMed", "id": "18621030", "url": "https://glygen.org/publication/PubMed/18621030" } ] }, { "title": "Methamphetamine-induced neuronal protein NAT8L is the NAA biosynthetic enzyme: implications for specialized acetyl coenzyme A metabolism in the CNS.", "journal": "Brain Res.", "date": "2010", "authors": "Ariyannur PS, Moffett JR, Manickam P, Pattabiraman N, Arun P, Nitta A, Nabeshima T, Madhavarao CN, Namboodiri AM", "evidence": [ { "database": "UniProtKB", "id": "D3ZVU9", "url": "https://www.uniprot.org/uniprot/D3ZVU9" }, { "database": "RefSeq", "id": "NP_001178610", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178610" } ], "reference": [ { "type": "PubMed", "id": "20385109", "url": "https://glygen.org/publication/PubMed/20385109" } ] }, { "title": "The molecular mechanisms affecting N-acetylaspartate homeostasis following experimental graded traumatic brain injury.", "journal": "Molecular medicine (Cambridge, Mass.)", "date": "2014", "authors": "Di Pietro V, Amorini AM, Tavazzi B, Vagnozzi R, Logan A, Lazzarino G, Signoretti S, Lazzarino G, Belli A", "evidence": [ { "database": "RefSeq", "id": "NP_001178610", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178610" } ], "reference": [ { "type": "PubMed", "id": "24515258", "url": "https://glygen.org/publication/PubMed/24515258" } ] } ], "pathway": [ { "id": "rno:289727", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:289727", "resource": "KEGG Pathway" }, { "id": "R-RNO-8963693", "name": "Aspartate and asparagine metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8963693", "resource": "Reactome", "description": "Aspartate and asparagine metabolism" } ], "orthologs": [ { "uniprot_canonical_ac": "Q3UGX3-1", "protein_name": "N-acetylaspartate synthetase", "gene_name": "Nat8l", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MHCGPPDMVCETKIVATEDHEALPGAKKDALLVAAGAMWPPLPAAPGPAAAPPPAAGPQPHGGTGGAGPPEGRGVCIREFRAAEQEAARRIFYDGILERIPNTAFRGLRQHPRTQLLYALLAALCFAVTRSLLLTCLVPAGLLALRYYYSRKVILAYLECALHTDMADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKSIAKALGRRVLEFAMLHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE", "length": 299 }, "evidence": [ { "id": "45237423", "url": "http://www.informatics.jax.org/homology/45237423", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8N9F0-1", "protein_name": "N-acetylaspartate synthetase", "gene_name": "NAT8L", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MHCGPPDMVCETKIVAAEDHEALPGAKKDALLAAAGAMWPPLPAAPGPAAAPPAPPPAPVAQPHGGAGGAGPPGGRGVCIREFRAAEQEAARRIFYDGIMERIPNTAFRGLRQHPRAQLLYALLAALCFAVSRSLLLTCLVPAALLGLRYYYSRKVIRAYLECALHTDMADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE", "length": 302 }, "evidence": [ { "id": "45237423", "url": "http://www.informatics.jax.org/homology/45237423", "database": "MGI" }, { "id": "D3ZVU9", "url": "https://omabrowser.org/oma/group/D3ZVU9/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "positive regulation of dopamine uptake involved in synaptic transmission", "id": "GO:0051586", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051586", "evidence": [ { "database": "UniProtKB", "id": "D3ZVU9", "url": "https://www.uniprot.org/uniprot/D3ZVU9" } ], "pmid": "" }, { "name": "acetate metabolic process", "id": "GO:0006083", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006083", "evidence": [ { "database": "UniProtKB", "id": "D3ZVU9", "url": "https://www.uniprot.org/uniprot/D3ZVU9" } ], "pmid": "" }, { "name": "aspartate metabolic process", "id": "GO:0006531", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006531", "evidence": [ { "database": "UniProtKB", "id": "D3ZVU9", "url": "https://www.uniprot.org/uniprot/D3ZVU9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "D3ZVU9", "url": "https://www.uniprot.org/uniprot/D3ZVU9" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "D3ZVU9", "url": "https://www.uniprot.org/uniprot/D3ZVU9" } ], "pmid": "" }, { "name": "mitochondrial matrix", "id": "GO:0005759", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005759", "evidence": [ { "database": "UniProtKB", "id": "D3ZVU9", "url": "https://www.uniprot.org/uniprot/D3ZVU9" } ], "pmid": "" }, { "name": "mitochondrial membrane", "id": "GO:0031966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031966", "evidence": [ { "database": "UniProtKB", "id": "D3ZVU9", "url": "https://www.uniprot.org/uniprot/D3ZVU9" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "D3ZVU9", "url": "https://www.uniprot.org/uniprot/D3ZVU9" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "D3ZVU9", "url": "https://www.uniprot.org/uniprot/D3ZVU9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "aspartate N-acetyltransferase activity", "id": "GO:0017188", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017188", "evidence": [ { "database": "UniProtKB", "id": "D3ZVU9", "url": "https://www.uniprot.org/uniprot/D3ZVU9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 237, "end_pos": 239, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "14165", "name": "", "equation": "acetyl-CoA + L-aspartate = CoA + H(+) + N-acetyl-L-aspartate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D3ZVU9-1", "Q8N9F0-1", "Q3UGX3-1" ], "evidence": [ { "id": "14165", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/14165" } ] }, { "id": "R-RNO-8954468", "name": "NAT8L transfers acetyl group from Ac-CoA to L-Asp, forming NAA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial matrix", "input_participant_list": [], "output_participant_list": [ "R-ALL-8954466" ], "enzyme_list": [ "D3ZVU9-1" ], "evidence": [ { "id": "R-RNO-8954468", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8954468" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-8954466", "participant_name": "NAA [mitochondrial matrix]", "crossref": [ { "id": "21547", "database": "ChEBI", "url": "" }, { "id": "HMDB0000812", "database": "HMDB Metabolite", "url": "" }, { "id": "C01042", "database": "COMPOUND", "url": "" }, { "id": "000002446417", "database": "ZINC", "url": "" }, { "id": "21547", "database": "ChEBI", "url": "" }, { "id": "HMDB0000812", "database": "HMDB Metabolite", "url": "" }, { "id": "C01042", "database": "COMPOUND", "url": "" }, { "id": "000002446417", "database": "ZINC", "url": "" }, { "id": "21547", "database": "ChEBI", "url": "" }, { "id": "HMDB0000812", "database": "HMDB Metabolite", "url": "" }, { "id": "C01042", "database": "COMPOUND", "url": "" }, { "id": "000002446417", "database": "ZINC", "url": "" }, { "id": "C01042", "database": "COMPOUND", "url": "" }, { "id": "21547", "database": "ChEBI", "url": "" }, { "id": "000002446417", "database": "ZINC", "url": "" }, { "id": "HMDB0000812", "database": "HMDB Metabolite", "url": "" }, { "id": "21547", "database": "ChEBI", "url": "" }, { "id": "HMDB0000812", "database": "HMDB Metabolite", "url": "" }, { "id": "C01042", "database": "COMPOUND", "url": "" }, { "id": "000002446417", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "D3ZVU9", "gene_name": "Nat8l", "activity": [ { "ec_number": "2.3.1.17", "activity": "acetyl-CoA + L-aspartate = CoA + H(+) + N-acetyl-L-aspartate.", "evidence": [ { "id": "D3ZVU9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZVU9" } ] } ] }, { "uniprot_ac": "Q3UGX3", "gene_name": "Nat8l", "activity": [ { "ec_number": "2.3.1.17", "activity": "acetyl-CoA + L-aspartate = CoA + H(+) + N-acetyl-L-aspartate.", "evidence": [ { "id": "Q3UGX3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UGX3" } ] }, { "ec_number": "2.3.1.17", "activity": "", "evidence": [ { "id": "Q3UGX3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UGX3" } ] } ] }, { "uniprot_ac": "Q8N9F0", "gene_name": "NAT8L", "activity": [ { "ec_number": "2.3.1.17", "activity": "acetyl-CoA + L-aspartate = CoA + H(+) + N-acetyl-L-aspartate.", "evidence": [ { "id": "Q8N9F0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N9F0" } ] }, { "ec_number": "2.3.1.17", "activity": "", "evidence": [ { "id": "Q8N9F0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N9F0" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }