{ "uniprot_canonical_ac": "D3ZVA9-1", "uniprot_ac": "D3ZVA9", "uniprot_id": "D3ZVA9_RAT", "mass": { "chemical_mass": 37815.0, "monoisotopic_mass": 37815.0 }, "refseq": { "ac": "NP_001102841", "name": "acyl-CoA wax alcohol acyltransferase 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102841" }, "gene_names": [ { "name": "Awat1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D3ZVA9", "id": "D3ZVA9" }, { "name": "Awat1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102841", "id": "NP_001102841" }, { "name": "Dgat2l3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102841", "id": "NP_001102841" } ], "protein_names": [ { "name": "Acyltransferase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "D3ZVA9" }, { "name": "2.3.1.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D3ZVA9" }, { "name": "acyl-CoA wax alcohol acyltransferase 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102841", "id": "NP_001102841" }, { "name": "wax synthase 1; diacylglycerol O-acyltransferase 2-like 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102841", "id": "NP_001102841" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D3ZVA9", "url": "https://www.uniprot.org/uniprot/D3ZVA9" } ], "common_name": "Rat" } ], "gene": [ { "name": "Awat1", "url": "https://www.uniprot.org/uniprot/D3ZVA9", "locus": { "chromosome": "X", "start_pos": 65674450, "end_pos": 65668205, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000026231", "url": "https://www.ensembl.org/id/ENSRNOG00000026231" } ] } } ], "crossref": [ { "id": "cd07987", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07987", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "679520", "url": "https://www.ncbi.nlm.nih.gov/gene/679520", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR007130", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007130", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:679520", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:679520", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "FYCCVFY", "url": "https://omabrowser.org/oma/group/FYCCVFY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "601258at2759", "url": "http://www.orthodb.org/?query=601258at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12317", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12317", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12317:SF16", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12317:SF16", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03982", "url": "http://pfam.xfam.org/family/PF03982", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-2142753", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2142753", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-9640463", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9640463", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001102841", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102841", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1587163", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1587163", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "D3ZVA9", "url": "https://www.uniprot.org/uniprot/D3ZVA9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZVA9-1", "url": "https://www.uniprot.org/uniprot/D3ZVA9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSCSMKLEYLQSLSLLQWPLSYLAIFWIVQPLFFSLFFTPLWLLPSLYVVWFILDWKTPNQGGRRSAWVRNWNIWTHIRDYFPITILKTKDLSPSQNYIMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPLIRDYIMAKGVCSVSQASIDYLLSHGTGNLVGIVVGGVGEALQSVPNTTTLILKKRKGFVRTALRHGAHLVPTFTFGETEVYDQVVFHEESRMFKFQSFFRRIFGFYFCVFYGQGFHQECKGLLPYHRPIVTVVGEPLPLPQVKNPSPEIVDKYHALYMDALYKLFEQHKVQYGCSDTQKLMFL", "length": 328, "header": "tr|D3ZVA9-1|D3ZVA9_RAT Isoform 1 of Acyltransferase OS=Rattus norvegicus OX=10116 GN=Awat1 PE=3 SV=1 CANONICAL=D3ZVA9-1" }, "isoforms": [ { "isoform_ac": "D3ZVA9-1", "url": "", "sequence": { "sequence": "MSCSMKLEYLQSLSLLQWPLSYLAIFWIVQPLFFSLFFTPLWLLPSLYVVWFILDWKTPNQGGRRSAWVRNWNIWTHIRDYFPITILKTKDLSPSQNYIMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPLIRDYIMAKGVCSVSQASIDYLLSHGTGNLVGIVVGGVGEALQSVPNTTTLILKKRKGFVRTALRHGAHLVPTFTFGETEVYDQVVFHEESRMFKFQSFFRRIFGFYFCVFYGQGFHQECKGLLPYHRPIVTVVGEPLPLPQVKNPSPEIVDKYHALYMDALYKLFEQHKVQYGCSDTQKLMFL", "length": 328, "header": "tr|D3ZVA9-1|D3ZVA9_RAT Isoform 1 of Acyltransferase OS=Rattus norvegicus OX=10116 GN=Awat1 PE=3 SV=1 CANONICAL=D3ZVA9-1" }, "locus": { "chromosome": "X", "start_pos": 65674129, "end_pos": 65668231, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000038924.5", "url": "https://www.ensembl.org/id/ENSRNOT00000038924.5" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000032529.3", "url": "https://www.ensembl.org/id/ENSRNOP00000032529.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "rno:679520", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:679520", "resource": "KEGG Pathway" }, { "id": "R-RNO-2142753", "name": "Arachidonic acid metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2142753", "resource": "Reactome", "description": "Arachidonic acid metabolism" }, { "id": "R-RNO-9640463", "name": "Wax biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9640463", "resource": "Reactome", "description": "Wax biosynthesis" } ], "orthologs": [ { "uniprot_canonical_ac": "A2ADU9-1", "protein_name": "Acyl-CoA wax alcohol acyltransferase 1", "gene_name": "Awat1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSCSMKTEHLQSLSLLQWPLSYVAMFWIVQPLLICLLFTPLWPLPTVYFVWLLLDWKTPDKGGRRSDWVRNWNVWNHIRDYFPITILKTKDLSPSENYIMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPIIRDYIMAKGLCSVSQASIDYLLSHGTGNLVGIVVGGVGEALQSVPNTTTLLLKKRKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHEDSRMFKFQSLFRRIFGFYCCVFYGQGFHQDCKGLLPYHKPIITVVGEALPLPQVKNPSPEIVDKYHALYMDALYKLFEQHKVQYGCSNTQKLIFL", "length": 328 }, "evidence": [ { "id": "45240433", "url": "http://www.informatics.jax.org/homology/45240433", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q58HT5-1", "protein_name": "Acyl-CoA wax alcohol acyltransferase 1", "gene_name": "AWAT1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAHSKQPSHFQSLMLLQWPLSYLAIFWILQPLFVYLLFTSLWPLPVLYFAWLFLDWKTPERGGRRSAWVRNWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVCSVSQPAINYLLSHGTGNLVGIVVGGVGEALQSVPNTTTLILQKRKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHKDSRMYKFQSCFRRIFGFYCCVFYGQSFCQGSTGLLPYSRPIVTVVGEPLPLPQIEKPSQEMVDKYHALYMDALHKLFDQHKTHYGCSETQKLFFL", "length": 328 }, "evidence": [ { "id": "45240433", "url": "http://www.informatics.jax.org/homology/45240433", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "D3ZVA9", "url": "https://www.uniprot.org/uniprot/D3ZVA9" } ], "pmid": "" }, { "name": "cellular lipid metabolic process", "id": "GO:0044255", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044255", "evidence": [ { "database": "UniProtKB", "id": "D3ZVA9", "url": "https://www.uniprot.org/uniprot/D3ZVA9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "D3ZVA9", "url": "https://www.uniprot.org/uniprot/D3ZVA9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "long-chain-alcohol O-fatty-acyltransferase activity", "id": "GO:0047196", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047196", "evidence": [ { "database": "UniProtKB", "id": "D3ZVA9", "url": "https://www.uniprot.org/uniprot/D3ZVA9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 191, "end_pos": 193, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-RNO-5696424", "name": "AWAT1 transfers acyl group from acyl-CoA to ARACOH, forming wax esters", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-192172", "R-ALL-5696426" ], "output_participant_list": [ "R-ALL-5696412" ], "enzyme_list": [ "D3ZVA9-1" ], "evidence": [ { "id": "R-RNO-5696424", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5696424" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-192172", "participant_name": "Acyl-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "C00040", "database": "COMPOUND", "url": "" }, { "id": "17984", "database": "ChEBI", "url": "" }, { "id": "C00040", "database": "COMPOUND", "url": "" }, { "id": "17984", "database": "ChEBI", "url": "" }, { "id": "C00040", "database": "COMPOUND", "url": "" }, { "id": "17984", "database": "ChEBI", "url": "" }, { "id": "C00040", "database": "COMPOUND", "url": "" }, { "id": "17984", "database": "ChEBI", "url": "" }, { "id": "17984", "database": "ChEBI", "url": "" }, { "id": "C00040", "database": "COMPOUND", "url": "" }, { "id": "C00040", "database": "COMPOUND", "url": "" }, { "id": "17984", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-5696412", "participant_name": "arachidyl ester [endoplasmic reticulum lumen]", "crossref": [ { "id": "10036", "database": "ChEBI", "url": "" }, { "id": "Wax-Esters", "database": "AraCyc", "url": "" }, { "id": "C01629", "database": "KEGG Gene", "url": "" }, { "id": "C01629", "database": "COMPOUND", "url": "" }, { "id": "10036", "database": "ChEBI", "url": "" }, { "id": "Wax-Esters", "database": "AraCyc", "url": "" }, { "id": "C01629", "database": "KEGG Gene", "url": "" }, { "id": "C01629", "database": "COMPOUND", "url": "" }, { "id": "10036", "database": "ChEBI", "url": "" }, { "id": "Wax-Esters", "database": "AraCyc", "url": "" }, { "id": "C01629", "database": "KEGG Gene", "url": "" }, { "id": "C01629", "database": "COMPOUND", "url": "" }, { "id": "10036", "database": "ChEBI", "url": "" }, { "id": "Wax-Esters", "database": "AraCyc", "url": "" }, { "id": "C01629", "database": "KEGG Gene", "url": "" }, { "id": "C01629", "database": "COMPOUND", "url": "" }, { "id": "Wax-Esters", "database": "AraCyc", "url": "" }, { "id": "C01629", "database": "COMPOUND", "url": "" }, { "id": "C01629", "database": "KEGG Gene", "url": "" }, { "id": "10036", "database": "ChEBI", "url": "" }, { "id": "10036", "database": "ChEBI", "url": "" }, { "id": "Wax-Esters", "database": "AraCyc", "url": "" }, { "id": "C01629", "database": "KEGG Gene", "url": "" }, { "id": "C01629", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-5696426", "participant_name": "ARACOH [endoplasmic reticulum lumen]", "crossref": [ { "id": "000032840992", "database": "ZINC", "url": "" }, { "id": "HMDB0011619", "database": "HMDB Metabolite", "url": "" }, { "id": "545111", "database": "ChEBI", "url": "" }, { "id": "75627", "database": "ChEBI", "url": "" }, { "id": "CPD-7869", "database": "AraCyc", "url": "" }, { "id": "12404", "database": "PubChem Compound", "url": "" }, { "id": "545111", "database": "ChEBI", "url": "" }, { "id": "000032840992", "database": "ZINC", "url": "" }, { "id": "HMDB0011619", "database": "HMDB Metabolite", "url": "" }, { "id": "12404", "database": "PubChem Compound", "url": "" }, { "id": "75627", "database": "ChEBI", "url": "" }, { "id": "CPD-7869", "database": "AraCyc", "url": "" }, { "id": "000032840992", "database": "ZINC", "url": "" }, { "id": "HMDB0011619", "database": "HMDB Metabolite", "url": "" }, { "id": "545111", "database": "ChEBI", "url": "" }, { "id": "75627", "database": "ChEBI", "url": "" }, { "id": "CPD-7869", "database": "AraCyc", "url": "" }, { "id": "12404", "database": "PubChem Compound", "url": "" }, { "id": "545111", "database": "ChEBI", "url": "" }, { "id": "000032840992", "database": "ZINC", "url": "" }, { "id": "HMDB0011619", "database": "HMDB Metabolite", "url": "" }, { "id": "12404", "database": "PubChem Compound", "url": "" }, { "id": "75627", "database": "ChEBI", "url": "" }, { "id": "CPD-7869", "database": "AraCyc", "url": "" }, { "id": "75627", "database": "ChEBI", "url": "" }, { "id": "545111", "database": "ChEBI", "url": "" }, { "id": "12404", "database": "PubChem Compound", "url": "" }, { "id": "000032840992", "database": "ZINC", "url": "" }, { "id": "CPD-7869", "database": "AraCyc", "url": "" }, { "id": "HMDB0011619", "database": "HMDB Metabolite", "url": "" }, { "id": "12404", "database": "PubChem Compound", "url": "" }, { "id": "CPD-7869", "database": "AraCyc", "url": "" }, { "id": "75627", "database": "ChEBI", "url": "" }, { "id": "HMDB0011619", "database": "HMDB Metabolite", "url": "" }, { "id": "000032840992", "database": "ZINC", "url": "" }, { "id": "545111", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "D3ZVA9", "gene_name": "Awat1", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "D3ZVA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZVA9" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }