{ "uniprot_canonical_ac": "D3ZUL1-1", "uniprot_ac": "D3ZUL1", "uniprot_id": "D3ZUL1_RAT", "mass": { "chemical_mass": 25318.0, "monoisotopic_mass": 25318.0 }, "refseq": { "ac": "NP_001099541", "name": "coiled-coil domain-containing protein 124", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099541" }, "gene_names": [ { "name": "Ccdc124", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D3ZUL1", "id": "D3ZUL1" }, { "name": "Ccdc124", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099541", "id": "NP_001099541" }, { "name": "RGD1310931", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099541", "id": "NP_001099541" } ], "protein_names": [ { "name": "Coiled-coil domain containing 124", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D3ZUL1" }, { "name": "coiled-coil domain-containing protein 124", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099541", "id": "NP_001099541" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D3ZUL1", "url": "https://www.uniprot.org/uniprot/D3ZUL1" } ], "common_name": "Rat" } ], "gene": [ { "name": "Ccdc124", "url": "https://www.uniprot.org/uniprot/D3ZUL1", "locus": { "chromosome": "16", "start_pos": 18572564, "end_pos": 18566745, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000018932", "url": "https://www.ensembl.org/id/ENSRNOG00000018932" } ] } } ], "crossref": [ { "id": "ENSRNOG00000018932", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000018932", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "290642", "url": "https://www.ncbi.nlm.nih.gov/gene/290642", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR010422", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010422", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:290642", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:290642", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "KEWQKGA", "url": "https://omabrowser.org/oma/group/KEWQKGA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "153920at2759", "url": "http://www.orthodb.org/?query=153920at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR21680", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21680", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21680:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21680:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF06244", "url": "http://pfam.xfam.org/family/PF06244", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001099541", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099541", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1310931", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1310931", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "D3ZUL1", "url": "https://www.uniprot.org/uniprot/D3ZUL1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZUL1-1", "url": "https://www.uniprot.org/uniprot/D3ZUL1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPKKFQGENSKSAAARARRAEAKAAADAKKQKELEDAYWKDEDKHVMRKEQRKEEKEKRRLEQLERKKETQRLLEEEDSRLKGGKAPRVAPAKVTRAQIEDSLRKEQRAEPVEKAKSHLELPLEENLNRRLQEEGSVEARTVEDAIAVLSVAEEADRHPERRMRAAFTAFEEVQLPRLKQENPNMRLSQLKQLLKKEWLRSPDNPMNQRALPFNAPK", "length": 217, "header": "tr|D3ZUL1-1|D3ZUL1_RAT Isoform 1 of Coiled-coil domain containing 124 OS=Rattus norvegicus OX=10116 GN=Ccdc124 PE=1 SV=1 CANONICAL=D3ZUL1-1" }, "isoforms": [ { "isoform_ac": "D3ZUL1-1", "url": "", "sequence": { "sequence": "MPKKFQGENSKSAAARARRAEAKAAADAKKQKELEDAYWKDEDKHVMRKEQRKEEKEKRRLEQLERKKETQRLLEEEDSRLKGGKAPRVAPAKVTRAQIEDSLRKEQRAEPVEKAKSHLELPLEENLNRRLQEEGSVEARTVEDAIAVLSVAEEADRHPERRMRAAFTAFEEVQLPRLKQENPNMRLSQLKQLLKKEWLRSPDNPMNQRALPFNAPK", "length": 217, "header": "tr|D3ZUL1-1|D3ZUL1_RAT Isoform 1 of Coiled-coil domain containing 124 OS=Rattus norvegicus OX=10116 GN=Ccdc124 PE=1 SV=1 CANONICAL=D3ZUL1-1" }, "locus": { "chromosome": "16", "start_pos": 18572091, "end_pos": 18570388, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000025626.6", "url": "https://www.ensembl.org/id/ENSRNOT00000025626.6" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000025626.4", "url": "https://www.ensembl.org/id/ENSRNOP00000025626.4" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nat. Commun.", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "D3ZUL1", "url": "https://www.uniprot.org/uniprot/D3ZUL1" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] } ], "pathway": [ { "id": "rno:290642", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:290642", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q96CT7-1", "protein_name": "Coiled-coil domain-containing protein 124", "gene_name": "CCDC124", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MPKKFQGENTKSAAARARRAEAKAAADAKKQKELEDAYWKDDDKHVMRKEQRKEEKEKRRLDQLERKKETQRLLEEEDSKLKGGKAPRVATSSKVTRAQIEDTLRRDHQLREAPDTAEKAKSHLEVPLEENVNRRVLEEGSVEARTIEDAIAVLSVAEEAADRHPERRMRAAFTAFEEAQLPRLKQENPNMRLSQLKQLLKKEWLRSPDNPMNQRAVPFNAPK", "length": 223 }, "evidence": [ { "id": "45226588", "url": "http://www.informatics.jax.org/homology/45226588", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9D8X2-1", "protein_name": "Coiled-coil domain-containing protein 124", "gene_name": "Ccdc124", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPKKFQGENSKSAAARARRAEAKAAADAKKQKELEDAYWKDEDKHVMRKEQRKEEKEKRRLEQLERKKETQRLLEEEDSRLKGGKAPRVAPAKVTRAQIEDSLRREQRAEPVEKAKSHLELPLEENLNRRLQEEGSVEARTVEDAIAVLSVAEEADRHPERRMRAAFTAFEEVQLPRLKQENPNMRLSQLKQLLKKEWLRSPDNPMNQRALPFNAPK", "length": 217 }, "evidence": [ { "id": "45226588", "url": "http://www.informatics.jax.org/homology/45226588", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "transcription coactivator activity", "id": "GO:0003713", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003713", "evidence": [ { "database": "UniProtKB", "id": "D3ZUL1", "url": "https://www.uniprot.org/uniprot/D3ZUL1" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "D3ZUL1", "url": "https://www.uniprot.org/uniprot/D3ZUL1" } ], "pmid": "" }, { "name": "midbody", "id": "GO:0030496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030496", "evidence": [ { "database": "UniProtKB", "id": "D3ZUL1", "url": "https://www.uniprot.org/uniprot/D3ZUL1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "transcription by RNA polymerase II", "id": "GO:0006366", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006366", "evidence": [ { "database": "UniProtKB", "id": "D3ZUL1", "url": "https://www.uniprot.org/uniprot/D3ZUL1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }