{ "uniprot_canonical_ac": "D3ZTZ4-1", "uniprot_ac": "D3ZTZ4", "uniprot_id": "D3ZTZ4_RAT", "mass": { "chemical_mass": 17678.0, "monoisotopic_mass": 17678.0 }, "refseq": { "ac": "XP_017454250", "name": "V-type proton ATPase subunit G 3 isoform X2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017454250" }, "gene_names": [ { "name": "Atp6v1g3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D3ZTZ4", "id": "D3ZTZ4" }, { "name": "Atp6v1g3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017454250", "id": "XP_017454250" } ], "protein_names": [ { "name": "V-type proton ATPase subunit G", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "D3ZTZ4" }, { "name": "V-type proton ATPase subunit G 3 isoform X2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017454250", "id": "XP_017454250" } ], "function": [ { "annotation": "Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment.", "evidence": [ { "database": "UniProtKB", "id": "D3ZTZ4", "url": "https://www.uniprot.org/uniprot/D3ZTZ4#function" }, { "database": "UniProtKB", "id": "RU364019", "url": "https://www.uniprot.org/uniprot/RU364019#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D3ZTZ4", "url": "https://www.uniprot.org/uniprot/D3ZTZ4" } ], "common_name": "Rat" } ], "gene": [ { "name": "Atp6v1g3", "url": "https://www.uniprot.org/uniprot/D3ZTZ4", "locus": { "chromosome": "13", "start_pos": 49825247, "end_pos": 49794222, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000022480", "url": "https://www.ensembl.org/id/ENSRNOG00000022480" } ] } } ], "crossref": [ { "id": "ENSRNOG00000022480", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000022480", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "289407", "url": "https://www.ncbi.nlm.nih.gov/gene/289407", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR005124", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005124", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:289407", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:289407", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "SYHRNME", "url": "https://omabrowser.org/oma/group/SYHRNME/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "33708at2759", "url": "http://www.orthodb.org/?query=33708at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12713", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12713", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12713:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12713:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03179", "url": "http://pfam.xfam.org/family/PF03179", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-1222556", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1222556", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-77387", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-77387", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-917977", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-917977", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9639288", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-983712", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983712", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_017454250", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017454250", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1304635", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1304635", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "D3ZTZ4", "url": "https://www.uniprot.org/uniprot/D3ZTZ4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZTZ4-1", "url": "https://www.uniprot.org/uniprot/D3ZTZ4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MCSLLTKQAEFGGDPLGNKRACASQLPQTSPSLEQDTMTSQSQGIQQLLQAEKRAKDKLDEAKKRKGKRLRQAKEEAVAETDQYRMQREKEFRLKQSKIMGSQSHLSDELEEQTLEKIKELSGSYHKCMDSVIKQLLSMVCEMKPEVHVNYRATS", "length": 155, "header": "tr|D3ZTZ4-1|D3ZTZ4_RAT Isoform 1 of V-type proton ATPase subunit G OS=Rattus norvegicus OX=10116 GN=Atp6v1g3 PE=1 SV=2 CANONICAL=D3ZTZ4-1" }, "isoforms": [ { "isoform_ac": "D3ZTZ4-1", "url": "", "sequence": { "sequence": "MCSLLTKQAEFGGDPLGNKRACASQLPQTSPSLEQDTMTSQSQGIQQLLQAEKRAKDKLDEAKKRKGKRLRQAKEEAVAETDQYRMQREKEFRLKQSKIMGSQSHLSDELEEQTLEKIKELSGSYHKCMDSVIKQLLSMVCEMKPEVHVNYRATS", "length": 155, "header": "tr|D3ZTZ4-1|D3ZTZ4_RAT Isoform 1 of V-type proton ATPase subunit G OS=Rattus norvegicus OX=10116 GN=Atp6v1g3 PE=1 SV=2 CANONICAL=D3ZTZ4-1" }, "locus": { "chromosome": "13", "start_pos": 49823910, "end_pos": 49810715, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000029679.5", "url": "https://www.ensembl.org/id/ENSRNOT00000029679.5" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000032126.5", "url": "https://www.ensembl.org/id/ENSRNOP00000032126.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nat. Commun.", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "D3ZTZ4", "url": "https://www.uniprot.org/uniprot/D3ZTZ4" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] } ], "pathway": [ { "id": "rno:289407", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:289407", "resource": "KEGG Pathway" }, { "id": "R-RNO-1222556", "name": "ROS and RNS production in phagocytes", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1222556", "resource": "Reactome", "description": "ROS and RNS production in phagocytes" }, { "id": "R-RNO-77387", "name": "Insulin receptor recycling", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-77387", "resource": "Reactome", "description": "Insulin receptor recycling" }, { "id": "R-RNO-917977", "name": "Transferrin endocytosis and recycling", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-917977", "resource": "Reactome", "description": "Transferrin endocytosis and recycling" }, { "id": "R-RNO-9639288", "name": "Amino acids regulate mTORC1", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9639288", "resource": "Reactome", "description": "Amino acids regulate mTORC1" }, { "id": "R-RNO-983712", "name": "Ion channel transport", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983712", "resource": "Reactome", "description": "Ion channel transport" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8BMC1-1", "protein_name": "V-type proton ATPase subunit G 3", "gene_name": "Atp6v1g3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTSQSQGIQQLLQAEKRAKDKLDEAKKRKGKRLRQAKEEAVAETDQYRMQMEKDFRLKQAKIMGSQSHLSDEIEEQTLEKIKELNGSYNKCMESVIKQLLSMVCDMKPEVHVNYRATN", "length": 118 }, "evidence": [ { "id": "45240427", "url": "http://www.informatics.jax.org/homology/45240427", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q96LB4-1", "protein_name": "V-type proton ATPase subunit G 3", "gene_name": "ATP6V1G3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN", "length": 118 }, "evidence": [ { "id": "45240427", "url": "http://www.informatics.jax.org/homology/45240427", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "D3ZTZ4", "url": "https://www.uniprot.org/uniprot/D3ZTZ4" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "D3ZTZ4", "url": "https://www.uniprot.org/uniprot/D3ZTZ4" } ], "pmid": "" }, { "name": "vacuolar proton-transporting V-type ATPase complex", "id": "GO:0016471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016471", "evidence": [ { "database": "UniProtKB", "id": "D3ZTZ4", "url": "https://www.uniprot.org/uniprot/D3ZTZ4" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "ATPase binding", "id": "GO:0051117", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051117", "evidence": [ { "database": "UniProtKB", "id": "D3ZTZ4", "url": "https://www.uniprot.org/uniprot/D3ZTZ4" } ], "pmid": "" }, { "name": "proton-transporting ATPase activity, rotational mechanism", "id": "GO:0046961", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046961", "evidence": [ { "database": "UniProtKB", "id": "D3ZTZ4", "url": "https://www.uniprot.org/uniprot/D3ZTZ4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "proton transmembrane transport", "id": "GO:1902600", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902600", "evidence": [ { "database": "UniProtKB", "id": "D3ZTZ4", "url": "https://www.uniprot.org/uniprot/D3ZTZ4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }