{ "uniprot_canonical_ac": "D3ZS24-1", "uniprot_ac": "D3ZS24", "uniprot_id": "D3ZS24_RAT", "mass": { "chemical_mass": 30805.0, "monoisotopic_mass": 30805.0 }, "refseq": { "ac": "XP_006250346", "name": "SLAM family member 8 isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006250346" }, "gene_names": [ { "name": "Slamf8", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D3ZS24", "id": "D3ZS24" }, { "name": "Slamf8", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006250346", "id": "XP_006250346" } ], "protein_names": [ { "name": "SLAM family member 8 isoform X1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006250346", "id": "XP_006250346" }, { "name": "SLAM family member 8", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D3ZS24" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D3ZS24", "url": "https://www.uniprot.org/uniprot/D3ZS24" } ], "common_name": "Rat" } ], "gene": [ { "name": "Slamf8", "url": "https://www.uniprot.org/uniprot/D3ZS24", "locus": { "chromosome": "13", "start_pos": 85047727, "end_pos": 85057211, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000008736", "url": "https://www.ensembl.org/id/ENSRNOG00000008736" } ] } } ], "crossref": [ { "id": "ENSRNOG00000008736", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000008736", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "289237", "url": "https://www.ncbi.nlm.nih.gov/gene/289237", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:289237", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:289237", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "RREGTMD", "url": "https://omabrowser.org/oma/group/RREGTMD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4599119at2759", "url": "http://www.orthodb.org/?query=4599119at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12080", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12080", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12080:SF92", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12080:SF92", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "XP_006250346", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006250346", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1306263", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1306263", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "D3ZS24", "url": "https://www.uniprot.org/uniprot/D3ZS24", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZS24-1", "url": "https://www.uniprot.org/uniprot/D3ZS24-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MWSLWSLLLFQGLLPIVVISVQVLSKVGDSGLLVAECPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRVQLYDNLSLELGPLRTGDSGNFSVLMVDTGGQTWTQTLHLKVYDAVPKPEVQVFTAATEEAQPLNTCQVFLSCWAPNISDITYSWRREGTMDFNGELRSLFSNGQVLSVSLGLGDKDVAFTCIASNPVSWDMTTVTPWESCHHEAASSGKASYKDVLLVVMPITLFLILAGLFGAWHHGLCSAGKRKDACTDRALPETESAVA", "length": 280, "header": "tr|D3ZS24-1|D3ZS24_RAT Isoform 1 of SLAM family member 8 OS=Rattus norvegicus OX=10116 GN=Slamf8 PE=4 SV=2 CANONICAL=D3ZS24-1" }, "isoforms": [ { "isoform_ac": "D3ZS24-1", "url": "", "sequence": { "sequence": "MWSLWSLLLFQGLLPIVVISVQVLSKVGDSGLLVAECPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRVQLYDNLSLELGPLRTGDSGNFSVLMVDTGGQTWTQTLHLKVYDAVPKPEVQVFTAATEEAQPLNTCQVFLSCWAPNISDITYSWRREGTMDFNGELRSLFSNGQVLSVSLGLGDKDVAFTCIASNPVSWDMTTVTPWESCHHEAASSGKASYKDVLLVVMPITLFLILAGLFGAWHHGLCSAGKRKDACTDRALPETESAVA", "length": 280, "header": "tr|D3ZS24-1|D3ZS24_RAT Isoform 1 of SLAM family member 8 OS=Rattus norvegicus OX=10116 GN=Slamf8 PE=4 SV=2 CANONICAL=D3ZS24-1" }, "locus": { "chromosome": "13", "start_pos": 85057126, "end_pos": 85048819, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000011869.7", "url": "https://www.ensembl.org/id/ENSRNOT00000011869.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000011869.6", "url": "https://www.ensembl.org/id/ENSRNOP00000011869.6" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:289237", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:289237", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9D3G2-1", "protein_name": "SLAM family member 8", "gene_name": "Slamf8", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MWSLWSLLLFEALLPVVVVSVQVLSKVGDSELLVAECPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRVQLYDNLSLELGPLKPGDSGNFSVLMVDTGGQTWTQTLYLKVYDAVPKPEVQVFTAAAEETQPLNTCQVFLSCWAPNISDITYSWRWEGTVDFNGEVRSHFSNGQVLSVSLGLGDKDVAFTCIASNPVSWDMTTVTPWESCHHEAASGKASYKDVLLVVVPITLFLILAGLFGAWHHGLCSGKKKDACTDGVLPETENALV", "length": 278 }, "evidence": [ { "id": "45243659", "url": "http://www.informatics.jax.org/homology/45243659", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9P0V8-1", "protein_name": "SLAM family member 8", "gene_name": "SLAMF8", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MVMRPLWSLLLWEALLPITVTGAQVLSKVGGSVLLVAARPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRAQLHSNLSLELGPLESGDSGNFSVLMVDTRGQPWTQTLQLKVYDAVPRPVVQVFIAVERDAQPSKTCQVFLSCWAPNISEITYSWRRETTMDFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPWDSCHHEAAPGKASYKDVLLVVVPVSLLLMLVTLFSAWHWCPCSGKKKKDVHADRVGPETENPLVQDLP", "length": 285 }, "evidence": [ { "id": "45243659", "url": "http://www.informatics.jax.org/homology/45243659", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 13, "go_terms": [ { "name": "regulation of B cell differentiation", "id": "GO:0045577", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045577", "evidence": [ { "database": "UniProtKB", "id": "D3ZS24", "url": "https://www.uniprot.org/uniprot/D3ZS24" } ], "pmid": "" }, { "name": "negative regulation of monocyte chemotaxis", "id": "GO:0090027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090027", "evidence": [ { "database": "UniProtKB", "id": "D3ZS24", "url": "https://www.uniprot.org/uniprot/D3ZS24" } ], "pmid": "" }, { "name": "phagosome acidification", "id": "GO:0090383", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090383", "evidence": [ { "database": "UniProtKB", "id": "D3ZS24", "url": "https://www.uniprot.org/uniprot/D3ZS24" } ], "pmid": "" }, { "name": "cellular response to xenobiotic stimulus", "id": "GO:0071466", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071466", "evidence": [ { "database": "UniProtKB", "id": "D3ZS24", "url": "https://www.uniprot.org/uniprot/D3ZS24" } ], "pmid": "" }, { "name": "defense response to bacterium", "id": "GO:0042742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042742", "evidence": [ { "database": "UniProtKB", "id": "D3ZS24", "url": "https://www.uniprot.org/uniprot/D3ZS24" } ], "pmid": "" }, { "name": "negative regulation of respiratory burst involved in inflammatory response", "id": "GO:0060266", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060266", "evidence": [ { "database": "UniProtKB", "id": "D3ZS24", "url": "https://www.uniprot.org/uniprot/D3ZS24" } ], "pmid": "" }, { "name": "negative regulation of macrophage chemotaxis", "id": "GO:0010760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010760", "evidence": [ { "database": "UniProtKB", "id": "D3ZS24", "url": "https://www.uniprot.org/uniprot/D3ZS24" } ], "pmid": "" }, { "name": "leukocyte chemotaxis involved in inflammatory response", "id": "GO:0002232", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002232", "evidence": [ { "database": "UniProtKB", "id": "D3ZS24", "url": "https://www.uniprot.org/uniprot/D3ZS24" } ], "pmid": "" }, { "name": "regulation of kinase activity", "id": "GO:0043549", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043549", "evidence": [ { "database": "UniProtKB", "id": "D3ZS24", "url": "https://www.uniprot.org/uniprot/D3ZS24" } ], "pmid": "" }, { "name": "regulation of NAD(P)H oxidase activity", "id": "GO:0033860", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033860", "evidence": [ { "database": "UniProtKB", "id": "D3ZS24", "url": "https://www.uniprot.org/uniprot/D3ZS24" } ], "pmid": "" }, { "name": "negative regulation of neutrophil migration", "id": "GO:1902623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902623", "evidence": [ { "database": "UniProtKB", "id": "D3ZS24", "url": "https://www.uniprot.org/uniprot/D3ZS24" } ], "pmid": "" }, { "name": "negative regulation of dendritic cell chemotaxis", "id": "GO:2000509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000509", "evidence": [ { "database": "UniProtKB", "id": "D3ZS24", "url": "https://www.uniprot.org/uniprot/D3ZS24" } ], "pmid": "" }, { "name": "B-1 B cell lineage commitment", "id": "GO:0002336", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002336", "evidence": [ { "database": "UniProtKB", "id": "D3ZS24", "url": "https://www.uniprot.org/uniprot/D3ZS24" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "D3ZS24", "url": "https://www.uniprot.org/uniprot/D3ZS24" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "D3ZS24", "url": "https://www.uniprot.org/uniprot/D3ZS24" } ], "pmid": "" }, { "name": "signaling receptor activity", "id": "GO:0038023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038023", "evidence": [ { "database": "UniProtKB", "id": "D3ZS24", "url": "https://www.uniprot.org/uniprot/D3ZS24" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 154, "end_pos": 156, "annotation": "n_glycosylation_sequon" }, { "start_pos": 83, "end_pos": 85, "annotation": "n_glycosylation_sequon" }, { "start_pos": 98, "end_pos": 100, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }