{ "uniprot_canonical_ac": "D3ZQM6-1", "uniprot_ac": "D3ZQM6", "uniprot_id": "D3ZQM6_RAT", "mass": { "chemical_mass": 20804.0, "monoisotopic_mass": 20804.0 }, "refseq": { "ac": "NP_001100273", "name": "methyl-CpG-binding domain protein 3-like 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100273" }, "gene_names": [ { "name": "Mbd3l1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D3ZQM6", "id": "D3ZQM6" }, { "name": "Mbd3l1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100273", "id": "NP_001100273" } ], "protein_names": [ { "name": "Methyl-CpG binding domain protein 3-like 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D3ZQM6" }, { "name": "methyl-CpG-binding domain protein 3-like 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100273", "id": "NP_001100273" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D3ZQM6", "url": "https://www.uniprot.org/uniprot/D3ZQM6" } ], "common_name": "Rat" } ], "gene": [ { "name": "Mbd3l1", "url": "https://www.uniprot.org/uniprot/D3ZQM6", "locus": { "chromosome": "8", "start_pos": 16160404, "end_pos": 16153472, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000006363", "url": "https://www.ensembl.org/id/ENSRNOG00000006363" } ] } } ], "crossref": [ { "id": "ENSRNOG00000006363", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000006363", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "300389", "url": "https://www.ncbi.nlm.nih.gov/gene/300389", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR025884", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025884", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032343", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032343", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:300389", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:300389", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HDCGNQS", "url": "https://omabrowser.org/oma/group/HDCGNQS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5262043at2759", "url": "http://www.orthodb.org/?query=5262043at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PF14048", "url": "http://pfam.xfam.org/family/PF14048", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF16564", "url": "http://pfam.xfam.org/family/PF16564", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_D3ZQM6", "url": "http://purl.obolibrary.org/obo/PR_D3ZQM6", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001100273", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100273", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1308259", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1308259", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "D3ZQM6", "url": "https://www.uniprot.org/uniprot/D3ZQM6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZQM6-1", "url": "https://www.uniprot.org/uniprot/D3ZQM6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGKTSQRKQCDCENPSKPCLSTSIPLRMSNYTFKRPVTKITSHLGNEVRYYQWEETLEKPEQACWQKRLQGLQAYSSAGEILSTSDLSKALKDLTPRDTDAASSIIQANSMDPRPLSTLGSSSHLAKMIPEAGPQILCKEFLVTEEDISIQERKVKIARERLAVALIAHKLANETEKVRGSRKAKV", "length": 186, "header": "tr|D3ZQM6-1|D3ZQM6_RAT Isoform 1 of Methyl-CpG binding domain protein 3-like 1 OS=Rattus norvegicus OX=10116 GN=Mbd3l1 PE=4 SV=1 CANONICAL=D3ZQM6-1" }, "isoforms": [ { "isoform_ac": "D3ZQM6-1", "url": "", "sequence": { "sequence": "MGKTSQRKQCDCENPSKPCLSTSIPLRMSNYTFKRPVTKITSHLGNEVRYYQWEETLEKPEQACWQKRLQGLQAYSSAGEILSTSDLSKALKDLTPRDTDAASSIIQANSMDPRPLSTLGSSSHLAKMIPEAGPQILCKEFLVTEEDISIQERKVKIARERLAVALIAHKLANETEKVRGSRKAKV", "length": 186, "header": "tr|D3ZQM6-1|D3ZQM6_RAT Isoform 1 of Methyl-CpG binding domain protein 3-like 1 OS=Rattus norvegicus OX=10116 GN=Mbd3l1 PE=4 SV=1 CANONICAL=D3ZQM6-1" }, "locus": { "chromosome": "8", "start_pos": 16160212, "end_pos": 16159655, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000008341.4", "url": "https://www.ensembl.org/id/ENSRNOT00000008341.4" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000008341.2", "url": "https://www.ensembl.org/id/ENSRNOP00000008341.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:300389", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:300389", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8WWY6-1", "protein_name": "Methyl-CpG-binding domain protein 3-like 1", "gene_name": "MBD3L1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRRLQGLQAYSSAGELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMPHLACSSDAVEIIPAEGVGISQLLCKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANEAEKVRDQEGRPEKR", "length": 194 }, "evidence": [ { "id": "45242027", "url": "http://www.informatics.jax.org/homology/45242027", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9D9H3-1", "protein_name": "Methyl-CpG-binding domain protein 3-like 1", "gene_name": "Mbd3l1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGKTSQRKQCDCENPSKPCLSTSIPLRMSSYTFKRPVTKITSHLGNEVRYYQWEETLEKPEQACWQKRLQGLQAYSSAGELLSTSDLAKTLKDLTSTDTVASASDTQATSIDITSVPTLESSSHLANMIPEAGPQILCKEFLVTEQDIINQERKVKIARERLAVALIAHKLASEMETVRGSRKANL", "length": 186 }, "evidence": [ { "id": "45242027", "url": "http://www.informatics.jax.org/homology/45242027", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "D3ZQM6", "url": "https://www.uniprot.org/uniprot/D3ZQM6" } ], "pmid": "" }, { "name": "DNA methylation-dependent heterochromatin formation", "id": "GO:0006346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006346", "evidence": [ { "database": "UniProtKB", "id": "D3ZQM6", "url": "https://www.uniprot.org/uniprot/D3ZQM6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "D3ZQM6", "url": "https://www.uniprot.org/uniprot/D3ZQM6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "methyl-CpG binding", "id": "GO:0008327", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008327", "evidence": [ { "database": "UniProtKB", "id": "D3ZQM6", "url": "https://www.uniprot.org/uniprot/D3ZQM6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 173, "end_pos": 175, "annotation": "n_glycosylation_sequon" }, { "start_pos": 30, "end_pos": 32, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }