{ "uniprot_canonical_ac": "D3ZQ42-1", "uniprot_ac": "D3ZQ42", "uniprot_id": "D3ZQ42_RAT", "mass": { "chemical_mass": 34711.0, "monoisotopic_mass": 34711.0 }, "refseq": { "ac": "NP_001000524", "name": "olfactory receptor Olr1393", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000524" }, "gene_names": [ { "name": "Or2y15", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D3ZQ42", "id": "D3ZQ42" }, { "name": "Olr1393; ratchr10-34852920-34853855_ORF", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000524", "id": "NP_001000524" }, { "name": "Or2y15", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000524", "id": "NP_001000524" } ], "protein_names": [ { "name": "Olfactory receptor", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "D3ZQ42" }, { "name": "olfactory receptor Olr1393", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000524", "id": "NP_001000524" }, { "name": "olfactory receptor gene Olr1393; olfactory receptor 1393", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000524", "id": "NP_001000524" } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001000524", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000524" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D3ZQ42", "url": "https://www.uniprot.org/uniprot/D3ZQ42" } ], "common_name": "Rat" } ], "gene": [ { "name": "Or2y15", "url": "https://www.uniprot.org/uniprot/D3ZQ42", "locus": {} } ], "crossref": [ { "id": "cd15947", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15947", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "363585", "url": "https://www.ncbi.nlm.nih.gov/gene/363585", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:363585", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:363585", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "MEHANTS", "url": "https://omabrowser.org/oma/group/MEHANTS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4790557at2759", "url": "http://www.orthodb.org/?query=4790557at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR26453", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26453", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR26453:SF145", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26453:SF145", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "http://pfam.xfam.org/family/PF13853", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001000524", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000524", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1333419", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1333419", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "D3ZQ42", "url": "https://www.uniprot.org/uniprot/D3ZQ42", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZQ42-1", "url": "https://www.uniprot.org/uniprot/D3ZQ42-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGNFNTSSQESFILVGFSDWPQLQVFLFVIILIFYSLTIFGNTTIIILARLDLRLHKPMYFFLSHLSFLDLCYTTSTVPQLLINLYGLDRTISYGGCVAQLFIFLALASTECLILVAMAFDRYAAVCHPLHYTSIMHPILCRALAISSWVGGLVNSLIQTGLVMAMRLCGHQINHFFCEMPIFLKLACEDTGGTEVKMFVARTIVLVCPAVLILGSYVHIAKAVLKVKSMAGRRKAFGTCGSHLMVVSLFYGSGIYTYLQPVHKYSESKGKFVALFYTIVTPMFNPLIYTLRNKEVKGALWKMLGRGTDSG", "length": 311, "header": "tr|D3ZQ42-1|D3ZQ42_RAT Isoform 1 of Olfactory receptor OS=Rattus norvegicus OX=10116 GN=Or2y15 PE=3 SV=1 CANONICAL=D3ZQ42-1" }, "isoforms": [ { "isoform_ac": "D3ZQ42-1", "url": "", "sequence": { "sequence": "MGNFNTSSQESFILVGFSDWPQLQVFLFVIILIFYSLTIFGNTTIIILARLDLRLHKPMYFFLSHLSFLDLCYTTSTVPQLLINLYGLDRTISYGGCVAQLFIFLALASTECLILVAMAFDRYAAVCHPLHYTSIMHPILCRALAISSWVGGLVNSLIQTGLVMAMRLCGHQINHFFCEMPIFLKLACEDTGGTEVKMFVARTIVLVCPAVLILGSYVHIAKAVLKVKSMAGRRKAFGTCGSHLMVVSLFYGSGIYTYLQPVHKYSESKGKFVALFYTIVTPMFNPLIYTLRNKEVKGALWKMLGRGTDSG", "length": 311, "header": "tr|D3ZQ42-1|D3ZQ42_RAT Isoform 1 of Olfactory receptor OS=Rattus norvegicus OX=10116 GN=Or2y15 PE=3 SV=1 CANONICAL=D3ZQ42-1" }, "locus": { "chromosome": "10", "start_pos": 33708223, "end_pos": 33707291, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000111005.1", "url": "https://www.ensembl.org/id/ENSRNOT00000111005.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000094598.1", "url": "https://www.ensembl.org/id/ENSRNOP00000094598.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:363585", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:363585", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8NGV0-1", "protein_name": "Olfactory receptor 2Y1", "gene_name": "OR2Y1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGSFNTSFEDGFILVGFSDWPQLEPILFVFIFIFYSLTLFGNTIIIALSWLDLRLHTPMYFFLSHLSLLDLCFTTSTVPQLLINLCGVDRTITRGGCVAQLFIYLALGSTECVLLVVMAFDRYAAVCRPLHYMAIMHPHLCQTLAIASWGAGFVNSLIQTGLAMAMPLCGHRLNHFFCEMPVFLKLACADTEGTEAKMFVARVIVVAVPAALILGSYVHIAHAVLRVKSTAGRRKAFGTCGSHLLVVFLFYGSAIYTYLQSIHNYSEREGKFVALFYTIITPILNPLIYTLRNKDVKGALWKVLWRGRDSG", "length": 311 }, "evidence": [ { "id": "45242799", "url": "http://www.informatics.jax.org/homology/45242799", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8VFA9-1", "protein_name": "Olfactory receptor", "gene_name": "Or2y15", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGNFNTSTQESFILVGFSDWPQLQAFLFVIILIFYSLTIFGNTTIIVLARLDLRLHKPMYFFLSHLSFLDLCYTTSTVPQLLINLRGLDRTISYGGCVAQLFIFLALASTECLILVAMAFDRYAAVCHPLHYTSIMNPILCRALAISSWVGGLVNSLIQTGLVMAMRLCGHQINHFFCEMPIFLKLACEDTEGTEAKMFVARTIVLVCPAVLILGSYVHIAKAVLKVKSMAGRRKAFGTCGSHLMVVSLFYGSGIYTYLQPVHRYSESKGKFVALFYTIVTPMFNPLIYTLRNKDVKGALWKLLGRGTDSG", "length": 311 }, "evidence": [ { "id": "45242799", "url": "http://www.informatics.jax.org/homology/45242799", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "D3ZQ42", "url": "https://www.uniprot.org/uniprot/D3ZQ42" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "D3ZQ42", "url": "https://www.uniprot.org/uniprot/D3ZQ42" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "D3ZQ42", "url": "https://www.uniprot.org/uniprot/D3ZQ42" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "detection of chemical stimulus involved in sensory perception of smell", "id": "GO:0050911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050911", "evidence": [ { "database": "UniProtKB", "id": "D3ZQ42", "url": "https://www.uniprot.org/uniprot/D3ZQ42" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 42, "end_pos": 44, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }