{ "uniprot_canonical_ac": "D3ZGX2-1", "uniprot_ac": "D3ZGX2", "uniprot_id": "D3ZGX2_RAT", "mass": { "chemical_mass": 21613.0, "monoisotopic_mass": 21613.0 }, "refseq": { "ac": "NP_001181914", "name": "C-type lectin domain family 2 member M", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001181914" }, "gene_names": [ { "name": "RGD1564770", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D3ZGX2", "id": "D3ZGX2" }, { "name": "Clec2ml1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001181914", "id": "NP_001181914" }, { "name": "RGD1564770", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001181914", "id": "NP_001181914" } ], "protein_names": [ { "name": "C-type lectin domain family 2 member M", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001181914", "id": "NP_001181914" }, { "name": "C-type lectin domain family 2 member M", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D3ZGX2" }, { "name": "Similar to CD69 antigen (p60, early T-cell activation antigen)", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D3ZGX2" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D3ZGX2", "url": "https://www.uniprot.org/uniprot/D3ZGX2" } ], "common_name": "Rat" } ], "gene": [ { "name": "RGD1564770", "url": "https://www.uniprot.org/uniprot/D3ZGX2", "locus": { "chromosome": "4", "start_pos": 162768994, "end_pos": 162779899, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000057254", "url": "https://www.ensembl.org/id/ENSRNOG00000057254" } ] } } ], "crossref": [ { "id": "ENSRNOG00000057254", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000057254", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03593", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03593", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "500335", "url": "https://www.ncbi.nlm.nih.gov/gene/500335", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001304", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001304", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016186", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016186", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016187", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016187", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033992", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033992", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:500335", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:500335", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "IMSSMIC", "url": "https://omabrowser.org/oma/group/IMSSMIC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4009879at2759", "url": "http://www.orthodb.org/?query=4009879at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45710", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45710", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45710:SF20", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45710:SF20", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00059", "url": "http://pfam.xfam.org/family/PF00059", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001181914", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001181914", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1564770", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1564770", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "D3ZGX2", "url": "https://www.uniprot.org/uniprot/D3ZGX2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZGX2-1", "url": "https://www.uniprot.org/uniprot/D3ZGX2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MQTESSLRLSQSSHHRLTFDLKKVVTLWILVIGVIAVLLWGFFSFPKKFTVTRQTKNEVCSDGVKICLHGWNKLNRNCFTHFSHANSWFTAKETCKFHDATLAVFNDQTELDIVMKQMEDIQTFWIGLYKKDFRGPWVWTNGSKYNNWYEVQDYGHCAFLHKSGIDSTNCNDLKEYICTQEGHCP", "length": 185, "header": "tr|D3ZGX2-1|D3ZGX2_RAT Isoform 1 of Similar to CD69 antigen (p60, early T-cell activation antigen) OS=Rattus norvegicus OX=10116 GN=RGD1564770 PE=2 SV=1 CANONICAL=D3ZGX2-1" }, "isoforms": [ { "isoform_ac": "D3ZGX2-1", "url": "", "sequence": { "sequence": "MQTESSLRLSQSSHHRLTFDLKKVVTLWILVIGVIAVLLWGFFSFPKKFTVTRQTKNEVCSDGVKICLHGWNKLNRNCFTHFSHANSWFTAKETCKFHDATLAVFNDQTELDIVMKQMEDIQTFWIGLYKKDFRGPWVWTNGSKYNNWYEVQDYGHCAFLHKSGIDSTNCNDLKEYICTQEGHCP", "length": 185, "header": "tr|D3ZGX2-1|D3ZGX2_RAT Isoform 1 of Similar to CD69 antigen (p60, early T-cell activation antigen) OS=Rattus norvegicus OX=10116 GN=RGD1564770 PE=2 SV=1 CANONICAL=D3ZGX2-1" }, "locus": { "chromosome": "4", "start_pos": 162779691, "end_pos": 162769783, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000088759.2", "url": "https://www.ensembl.org/id/ENSRNOT00000088759.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000069958.1", "url": "https://www.ensembl.org/id/ENSRNOP00000069958.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The complete inventory of receptors encoded by the rat natural killer cell gene complex.", "journal": "Immunogenetics", "date": "2010", "authors": "Dissen E., Flornes L.M., Fossum S., Daws M.R., Saether P.C., Nylenna O.", "evidence": [ { "database": "UniProtKB", "id": "D3ZGX2", "url": "https://www.uniprot.org/uniprot/D3ZGX2" } ], "reference": [ { "type": "PubMed", "id": "20544345", "url": "https://glygen.org/publication/PubMed/20544345" } ] } ], "pathway": [ { "id": "rno:500335", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:500335", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8C634-1", "protein_name": "C-type lectin domain family 2, member m", "gene_name": "Clec2m", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MQTDTSPRLPQTSHERRHHRLMFDAKKVLTLWTLLGGAVAVLLWGFFSFPRKFTVTRTARNKTCDDEVKLCPKDWNKLRQNCFSRIQHKNSWLTANDTCELHDATLAVFIDKTEVEILMNQIQEMKTYWIGLHRQNLLGIWVWTNGSKYNNLHEIQDHGQCAFVHQKGIDSTSCEDQKEFICTREGQCP", "length": 189 }, "evidence": [ { "id": "45238528", "url": "http://www.informatics.jax.org/homology/45238528", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "D3ZGX2", "url": "https://www.uniprot.org/uniprot/D3ZGX2" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "carbohydrate binding", "id": "GO:0030246", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030246", "evidence": [ { "database": "UniProtKB", "id": "D3ZGX2", "url": "https://www.uniprot.org/uniprot/D3ZGX2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 141, "end_pos": 143, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }