{ "uniprot_canonical_ac": "D3ZFS1-1", "uniprot_ac": "D3ZFS1", "uniprot_id": "D3ZFS1_RAT", "mass": { "chemical_mass": 44855.0, "monoisotopic_mass": 44855.0 }, "refseq": { "ac": "NP_001178862", "name": "opsin-3", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178862" }, "gene_names": [ { "name": "Opn3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D3ZFS1", "id": "D3ZFS1" }, { "name": "Opn3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178862", "id": "NP_001178862" } ], "protein_names": [ { "name": "Opsin 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D3ZFS1" }, { "name": "opsin-3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178862", "id": "NP_001178862" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D3ZFS1", "url": "https://www.uniprot.org/uniprot/D3ZFS1" } ], "common_name": "Rat" } ], "gene": [ { "name": "Opn3", "url": "https://www.uniprot.org/uniprot/D3ZFS1", "locus": { "chromosome": "13", "start_pos": 87589333, "end_pos": 87619847, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000003778", "url": "https://www.ensembl.org/id/ENSRNOG00000003778" } ] } } ], "crossref": [ { "id": "ENSRNOG00000003778", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000003778", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "498289", "url": "https://www.ncbi.nlm.nih.gov/gene/498289", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027430", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027430", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:498289", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:498289", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "IMIYCYG", "url": "https://omabrowser.org/oma/group/IMIYCYG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2960637at2759", "url": "http://www.orthodb.org/?query=2960637at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24240", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24240", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24240:SF197", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24240:SF197", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00001", "url": "http://pfam.xfam.org/family/PF00001", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-418594", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-419771", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-419771", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001178862", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178862", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1594385", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1594385", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "D3ZFS1", "url": "https://www.uniprot.org/uniprot/D3ZFS1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZFS1-1", "url": "https://www.uniprot.org/uniprot/D3ZFS1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MYSGNRSGGQGYWEDGAGAEGAAPAGTRSPAPLFSPTAYERLALLLGCLALLGVGGNLLVLLLYSKFPRLRTPTHLFLVNLSLGDLLVSLFGVTFTFASCLRNGWVWDAVGCAWDGFSGSLFGFVSITTLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPMGIIAHCYGHILYSVRMLRCVEDLQTIQVIKMLRYEKKVAKMCFLMAFVFLTCWMPYVVTRFLVVNGYGHLVTPTVSIVSYLFAKSSTVYNPVIYIFMIRKFRRSLLQLLCFRLLRCQRPAKNLPAAESEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVEDSDRSSASKVDVIQVRPL", "length": 400, "header": "tr|D3ZFS1-1|D3ZFS1_RAT Isoform 1 of Opsin 3 OS=Rattus norvegicus OX=10116 GN=Opn3 PE=3 SV=1 CANONICAL=D3ZFS1-1" }, "isoforms": [ { "isoform_ac": "D3ZFS1-1", "url": "", "sequence": { "sequence": "MYSGNRSGGQGYWEDGAGAEGAAPAGTRSPAPLFSPTAYERLALLLGCLALLGVGGNLLVLLLYSKFPRLRTPTHLFLVNLSLGDLLVSLFGVTFTFASCLRNGWVWDAVGCAWDGFSGSLFGFVSITTLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPMGIIAHCYGHILYSVRMLRCVEDLQTIQVIKMLRYEKKVAKMCFLMAFVFLTCWMPYVVTRFLVVNGYGHLVTPTVSIVSYLFAKSSTVYNPVIYIFMIRKFRRSLLQLLCFRLLRCQRPAKNLPAAESEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVEDSDRSSASKVDVIQVRPL", "length": 400, "header": "tr|D3ZFS1-1|D3ZFS1_RAT Isoform 1 of Opsin 3 OS=Rattus norvegicus OX=10116 GN=Opn3 PE=3 SV=1 CANONICAL=D3ZFS1-1" }, "locus": { "chromosome": "13", "start_pos": 87619762, "end_pos": 87589799, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000005072.6", "url": "https://www.ensembl.org/id/ENSRNOT00000005072.6" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000005072.3", "url": "https://www.ensembl.org/id/ENSRNOP00000005072.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:498289", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:498289", "resource": "KEGG Pathway" }, { "id": "R-RNO-418594", "name": "G alpha (i) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-418594", "resource": "Reactome", "description": "G alpha (i) signalling events" }, { "id": "R-RNO-419771", "name": "Opsins", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-419771", "resource": "Reactome", "description": "Opsins" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9H1Y3-1", "protein_name": "Opsin-3", "gene_name": "OPN3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNLLVLVLYYKFQRLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFSGSLFGIVSIATLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPLGVIAHCYGHILYSIRMLRCVEDLQTIQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVNGHGHLVTPTISIVSYLFAKSNTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL", "length": 402 }, "evidence": [ { "id": "45229605", "url": "http://www.informatics.jax.org/homology/45229605", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9WUK7-1", "protein_name": "Opsin-3", "gene_name": "Opn3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MYSGNRSGDQGYWEDGAGAEGAAPAGTRSPAPLFSPTAYERLALLLGCLALLGVGGNLLVLLLYSKFPRLRTPTHLFLVNLSLGDLLVSLFGVTFTFASCLRNGWVWDAVGCAWDGFSGSLFGFVSITTLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDIHGLGCTVDWRSKDANDSSFVLFLFLGCLVVPVGIIAHCYGHILYSVRMLRCVEDLQTIQVIKMLRYEKKVAKMCFLMAFVFLTCWMPYIVTRFLVVNGYGHLVTPTVSIVSYLFAKSSTVYNPVIYIFMNRKFRRSLLQLLCFRLLRCQRPAKNLPAAESEMHIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVEDSDRSSASKVDVIQVRPL", "length": 400 }, "evidence": [ { "id": "45229605", "url": "http://www.informatics.jax.org/homology/45229605", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "negative regulation of melanin biosynthetic process", "id": "GO:0048022", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048022", "evidence": [ { "database": "UniProtKB", "id": "D3ZFS1", "url": "https://www.uniprot.org/uniprot/D3ZFS1" } ], "pmid": "" }, { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "D3ZFS1", "url": "https://www.uniprot.org/uniprot/D3ZFS1" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "D3ZFS1", "url": "https://www.uniprot.org/uniprot/D3ZFS1" } ], "pmid": "" }, { "name": "keratinocyte differentiation", "id": "GO:0030216", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030216", "evidence": [ { "database": "UniProtKB", "id": "D3ZFS1", "url": "https://www.uniprot.org/uniprot/D3ZFS1" } ], "pmid": "" }, { "name": "positive regulation of glucose import", "id": "GO:0046326", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046326", "evidence": [ { "database": "UniProtKB", "id": "D3ZFS1", "url": "https://www.uniprot.org/uniprot/D3ZFS1" } ], "pmid": "" }, { "name": "phototransduction", "id": "GO:0007602", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007602", "evidence": [ { "database": "UniProtKB", "id": "D3ZFS1", "url": "https://www.uniprot.org/uniprot/D3ZFS1" } ], "pmid": "" }, { "name": "positive regulation of melanin biosynthetic process", "id": "GO:0048023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048023", "evidence": [ { "database": "UniProtKB", "id": "D3ZFS1", "url": "https://www.uniprot.org/uniprot/D3ZFS1" } ], "pmid": "" }, { "name": "positive regulation of cellular respiration", "id": "GO:1901857", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901857", "evidence": [ { "database": "UniProtKB", "id": "D3ZFS1", "url": "https://www.uniprot.org/uniprot/D3ZFS1" } ], "pmid": "" }, { "name": "cellular response to UV-A", "id": "GO:0071492", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071492", "evidence": [ { "database": "UniProtKB", "id": "D3ZFS1", "url": "https://www.uniprot.org/uniprot/D3ZFS1" } ], "pmid": "" }, { "name": "cellular response to light stimulus", "id": "GO:0071482", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071482", "evidence": [ { "database": "UniProtKB", "id": "D3ZFS1", "url": "https://www.uniprot.org/uniprot/D3ZFS1" } ], "pmid": "" }, { "name": "response to blue light", "id": "GO:0009637", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009637", "evidence": [ { "database": "UniProtKB", "id": "D3ZFS1", "url": "https://www.uniprot.org/uniprot/D3ZFS1" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "D3ZFS1", "url": "https://www.uniprot.org/uniprot/D3ZFS1" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "D3ZFS1", "url": "https://www.uniprot.org/uniprot/D3ZFS1" } ], "pmid": "" }, { "name": "photoreceptor outer segment", "id": "GO:0001750", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001750", "evidence": [ { "database": "UniProtKB", "id": "D3ZFS1", "url": "https://www.uniprot.org/uniprot/D3ZFS1" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "all-trans retinal binding", "id": "GO:0005503", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005503", "evidence": [ { "database": "UniProtKB", "id": "D3ZFS1", "url": "https://www.uniprot.org/uniprot/D3ZFS1" } ], "pmid": "" }, { "name": "11-cis retinal binding", "id": "GO:0005502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005502", "evidence": [ { "database": "UniProtKB", "id": "D3ZFS1", "url": "https://www.uniprot.org/uniprot/D3ZFS1" } ], "pmid": "" }, { "name": "G protein-coupled photoreceptor activity", "id": "GO:0008020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008020", "evidence": [ { "database": "UniProtKB", "id": "D3ZFS1", "url": "https://www.uniprot.org/uniprot/D3ZFS1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 148, "end_pos": 150, "annotation": "n_glycosylation_sequon" }, { "start_pos": 196, "end_pos": 198, "annotation": "n_glycosylation_sequon" }, { "start_pos": 365, "end_pos": 367, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" }, { "start_pos": 80, "end_pos": 82, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }