{ "uniprot_canonical_ac": "D3ZDL1-1", "uniprot_ac": "D3ZDL1", "uniprot_id": "D3ZDL1_RAT", "mass": { "chemical_mass": 40508.0, "monoisotopic_mass": 40508.0 }, "refseq": { "ac": "NP_001099862", "name": "heparan sulfate glucosamine 3-O-sulfotransferase 5", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099862" }, "gene_names": [ { "name": "Hs3st5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D3ZDL1", "id": "D3ZDL1" }, { "name": "Hs3st5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099862", "id": "NP_001099862" } ], "protein_names": [ { "name": "Sulfotransferase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "D3ZDL1" }, { "name": "2.8.2.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D3ZDL1" }, { "name": "heparan sulfate (glucosamine) 3-O-sulfotransferase 5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099862", "id": "NP_001099862" }, { "name": "heparan sulfate glucosamine 3-O-sulfotransferase 5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099862", "id": "NP_001099862" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D3ZDL1", "url": "https://www.uniprot.org/uniprot/D3ZDL1" } ], "common_name": "Rat" } ], "gene": [ { "name": "Hs3st5", "url": "https://www.uniprot.org/uniprot/D3ZDL1", "locus": { "chromosome": "20", "start_pos": 40417653, "end_pos": 40106876, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000000605", "url": "https://www.ensembl.org/id/ENSRNOG00000000605" } ] } } ], "crossref": [ { "id": "ENSRNOG00000000605", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000000605", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "294449", "url": "https://www.ncbi.nlm.nih.gov/gene/294449", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000863", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000863", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037359", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037359", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:294449", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:294449", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "QRFFHPF", "url": "https://omabrowser.org/oma/group/QRFFHPF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "10019at2759", "url": "http://www.orthodb.org/?query=10019at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10605", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10605", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10605:SF46", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10605:SF46", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00685", "url": "http://pfam.xfam.org/family/PF00685", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-2022928", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2022928", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001099862", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099862", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1306379", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1306379", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "D3ZDL1", "url": "https://www.uniprot.org/uniprot/D3ZDL1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZDL1-1", "url": "https://www.uniprot.org/uniprot/D3ZDL1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLFKQQVWLRQKLLVLGSLAVGSLLYLVARVGSLDRLQPICPVESRFGAAHNQAELPLRALQFKRGLLHEFRKGNSSKEQVRLHDLVQQLPKAIIIGVRKGGTRALLEMLNLHPAVVKASQEIHFFDNDENYAKGIEWYRKKMPFSYPQQITIEKSPAYFITEEVPERIYKMNSSIKLLMIVREPTTRAISDYTQVLEGKERKNKTYYKFEKLAIDPNTCEVNTKYKAVRTSIYTKHLERWLKYFPIEQFHIVDGDRLITEPLPELQLVEKFLNLPPRISQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVVTKLRKFFHPFNQKFYQITGRTLNWP", "length": 346, "header": "tr|D3ZDL1-1|D3ZDL1_RAT Isoform 1 of Sulfotransferase OS=Rattus norvegicus OX=10116 GN=Hs3st5 PE=3 SV=1 CANONICAL=D3ZDL1-1" }, "isoforms": [ { "isoform_ac": "D3ZDL1-1", "url": "", "sequence": { "sequence": "MLFKQQVWLRQKLLVLGSLAVGSLLYLVARVGSLDRLQPICPVESRFGAAHNQAELPLRALQFKRGLLHEFRKGNSSKEQVRLHDLVQQLPKAIIIGVRKGGTRALLEMLNLHPAVVKASQEIHFFDNDENYAKGIEWYRKKMPFSYPQQITIEKSPAYFITEEVPERIYKMNSSIKLLMIVREPTTRAISDYTQVLEGKERKNKTYYKFEKLAIDPNTCEVNTKYKAVRTSIYTKHLERWLKYFPIEQFHIVDGDRLITEPLPELQLVEKFLNLPPRISQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVVTKLRKFFHPFNQKFYQITGRTLNWP", "length": 346, "header": "tr|D3ZDL1-1|D3ZDL1_RAT Isoform 1 of Sulfotransferase OS=Rattus norvegicus OX=10116 GN=Hs3st5 PE=3 SV=1 CANONICAL=D3ZDL1-1" }, "locus": { "chromosome": "20", "start_pos": 40416807, "end_pos": 40411663, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000000743.4", "url": "https://www.ensembl.org/id/ENSRNOT00000000743.4" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000000743.2", "url": "https://www.ensembl.org/id/ENSRNOP00000000743.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "rno:294449", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:294449", "resource": "KEGG Pathway" }, { "id": "R-RNO-2022928", "name": "HS-GAG biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2022928", "resource": "Reactome", "description": "HS-GAG biosynthesis" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8BSL4-1", "protein_name": "Heparan sulfate glucosamine 3-O-sulfotransferase 5", "gene_name": "Hs3st5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MLFKQQVWLRQKLLVLGSLAVGSLLYLVARVGSLDRLQPICPVESRFGGAHNQAELPLRALQFKRGLLHEFRKGNSSKEQVHLHDLVQQLPKAIIIGVRKGGTRALLEMLNLHPAVVKASQEIHFFDNDENYAKGIEWYRKKMPFSYPQQITIEKSPAYFITEEVPERIYKMNSSIKLLIIVREPTTRAISDYTQVLEGKERKNKTYYKFEKLAIDPNTCEVNTKYKAVRTSIYTKHLERWLKYFPIEQFHIVDGDRLITEPLPELQLVEKFLNLPPRISQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFHPFNQKFYQITGRTLNWP", "length": 346 }, "evidence": [ { "id": "45241519", "url": "http://www.informatics.jax.org/homology/45241519", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8IZT8-1", "protein_name": "Heparan sulfate glucosamine 3-O-sulfotransferase 5", "gene_name": "HS3ST5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MLFKQQAWLRQKLLVLGSLAVGSLLYLVARVGSLDRLQPICPIEGRLGGARTQAEFPLRALQFKRGLLHEFRKGNASKEQVRLHDLVQQLPKAIIIGVRKGGTRALLEMLNLHPAVVKASQEIHFFDNDENYGKGIEWYRKKMPFSYPQQITIEKSPAYFITEEVPERIYKMNSSIKLLIIVREPTTRAISDYTQVLEGKERKNKTYYKFEKLAIDPNTCEVNTKYKAVRTSIYTKHLERWLKYFPIEQFHVVDGDRLITEPLPELQLVEKFLNLPPRISQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFHPFNQKFYQITGRTLNWP", "length": 346 }, "evidence": [ { "id": "45241519", "url": "http://www.informatics.jax.org/homology/45241519", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "regulation of viral entry into host cell", "id": "GO:0046596", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046596", "evidence": [ { "database": "UniProtKB", "id": "D3ZDL1", "url": "https://www.uniprot.org/uniprot/D3ZDL1" } ], "pmid": "" }, { "name": "protein sulfation", "id": "GO:0006477", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006477", "evidence": [ { "database": "UniProtKB", "id": "D3ZDL1", "url": "https://www.uniprot.org/uniprot/D3ZDL1" } ], "pmid": "" }, { "name": "negative regulation of coagulation", "id": "GO:0050819", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050819", "evidence": [ { "database": "UniProtKB", "id": "D3ZDL1", "url": "https://www.uniprot.org/uniprot/D3ZDL1" } ], "pmid": "" }, { "name": "heparan sulfate proteoglycan biosynthetic process, enzymatic modification", "id": "GO:0015015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015015", "evidence": [ { "database": "UniProtKB", "id": "D3ZDL1", "url": "https://www.uniprot.org/uniprot/D3ZDL1" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity", "id": "GO:0008467", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008467", "evidence": [ { "database": "UniProtKB", "id": "D3ZDL1", "url": "https://www.uniprot.org/uniprot/D3ZDL1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 173, "end_pos": 175, "annotation": "n_glycosylation_sequon" }, { "start_pos": 204, "end_pos": 206, "annotation": "n_glycosylation_sequon" }, { "start_pos": 287, "end_pos": 289, "annotation": "n_glycosylation_sequon" }, { "start_pos": 75, "end_pos": 77, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-RNO-2076611", "name": "HS3STs sulfate GlcN at C3 in heparan sulfate", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D3ZDL1-1", "Q80W66-1", "D3ZFR1-1", "D3ZGJ6-1", "D3ZTA9-1" ], "evidence": [ { "id": "R-RNO-2076611", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2076611" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "D3ZDL1", "gene_name": "Hs3st5", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "D3ZDL1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZDL1" } ] } ] }, { "uniprot_ac": "D3ZFR1", "gene_name": "Hs3st3a1", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "D3ZFR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZFR1" } ] } ] }, { "uniprot_ac": "D3ZGJ6", "gene_name": "Hs3st6", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "D3ZGJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZGJ6" } ] } ] }, { "uniprot_ac": "D3ZTA9", "gene_name": "Hs3st3b1", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "D3ZTA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZTA9" } ] } ] }, { "uniprot_ac": "Q80W66", "gene_name": "Hs3st2", "activity": [ { "ec_number": "2.8.2.29", "activity": "3'-phosphoadenylyl sulfate + alpha-D-glucosaminyl-[heparan sulfate](n) = 3-sulfo-alpha-D-glucosaminyl-[heparan sulfate](n) + adenosine 3',5'-bisphosphate + H(+).", "evidence": [ { "id": "Q80W66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80W66" } ] }, { "ec_number": "2.8.2.29", "activity": "", "evidence": [ { "id": "Q80W66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80W66" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }