{ "uniprot_canonical_ac": "D3Z8T0-1", "uniprot_ac": "D3Z8T0", "uniprot_id": "D3Z8T0_RAT", "mass": { "chemical_mass": 9341.0, "monoisotopic_mass": 9341.0 }, "refseq": {}, "gene_names": [ { "name": "AABR07053402.1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D3Z8T0", "id": "D3Z8T0" }, { "name": "Hmgn2-ps3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/D3Z8T0", "id": "D3Z8T0" }, { "name": "Hmgn4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/D3Z8T0", "id": "D3Z8T0" } ], "protein_names": [ { "name": "High mobility group nucleosomal binding domain 4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D3Z8T0" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D3Z8T0", "url": "https://www.uniprot.org/uniprot/D3Z8T0" } ], "common_name": "Rat" } ], "gene": [ { "name": "AABR07053402.1", "url": "https://www.uniprot.org/uniprot/D3Z8T0", "locus": {} } ], "crossref": [ { "id": "ENSRNOG00000029847", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000029847", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR000079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23087", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23087", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23087:SF11", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23087:SF11", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01101", "url": "http://pfam.xfam.org/family/PF01101", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "15003779", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=15003779", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "2323648", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=2323648", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "D3Z8T0", "url": "https://www.uniprot.org/uniprot/D3Z8T0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z8T0-1", "url": "https://www.uniprot.org/uniprot/D3Z8T0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPKRKAERDAQGDEAKAKDEPQRRSARLSAKPAPSKPKKAPAKKREKIPKRKERKADAGKDANNPAENRDAKTGQAQKAEGAGVAK", "length": 86, "header": "tr|D3Z8T0-1|D3Z8T0_RAT Isoform 1 of High mobility group nucleosomal binding domain 4 OS=Rattus norvegicus OX=10116 GN=AABR07053402.1 PE=3 SV=3 CANONICAL=D3Z8T0-1" }, "isoforms": [ { "isoform_ac": "D3Z8T0-1", "url": "", "sequence": { "sequence": "MPKRKAERDAQGDEAKAKDEPQRRSARLSAKPAPSKPKKAPAKKREKIPKRKERKADAGKDANNPAENRDAKTGQAQKAEGAGVAK", "length": 86, "header": "tr|D3Z8T0-1|D3Z8T0_RAT Isoform 1 of High mobility group nucleosomal binding domain 4 OS=Rattus norvegicus OX=10116 GN=AABR07053402.1 PE=3 SV=3 CANONICAL=D3Z8T0-1" }, "locus": { "chromosome": "3", "start_pos": 99991003, "end_pos": 99990746, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000041537.3", "url": "https://www.ensembl.org/id/ENSRNOT00000041537.3" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000046982.3", "url": "https://www.ensembl.org/id/ENSRNOP00000046982.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "D3Z8T0", "url": "https://www.uniprot.org/uniprot/D3Z8T0" } ], "pmid": "" }, { "name": "nucleosomal DNA binding", "id": "GO:0031492", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031492", "evidence": [ { "database": "UniProtKB", "id": "D3Z8T0", "url": "https://www.uniprot.org/uniprot/D3Z8T0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "D3Z8T0", "url": "https://www.uniprot.org/uniprot/D3Z8T0" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "D3Z8T0", "url": "https://www.uniprot.org/uniprot/D3Z8T0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "chromatin organization", "id": "GO:0006325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006325", "evidence": [ { "database": "UniProtKB", "id": "D3Z8T0", "url": "https://www.uniprot.org/uniprot/D3Z8T0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }