{ "uniprot_canonical_ac": "D3Z6W3-1", "uniprot_ac": "D3Z6W3", "uniprot_id": "D3Z6W3_MOUSE", "mass": { "chemical_mass": 34700.0, "monoisotopic_mass": 34700.0 }, "refseq": { "ac": "NP_001025461", "name": "retinol dehydrogenase 8", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025461" }, "gene_names": [ { "name": "Rdh8", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D3Z6W3", "id": "D3Z6W3" }, { "name": "Gm182; prRDH", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025461", "id": "NP_001025461" }, { "name": "Rdh8", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025461", "id": "NP_001025461" } ], "protein_names": [ { "name": "Retinol dehydrogenase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "D3Z6W3" }, { "name": "1.1.1.300", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "D3Z6W3" }, { "name": "retinol dehydrogenase 8", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025461", "id": "NP_001025461" } ], "function": [ { "annotation": "Mice lacking both the ATP-binding cassette transporter 4 (Abca4) and enzyme retinol dehydrogenase 8 (Rdh8), proteins critical for all-trans-retinal clearance from photoreceptors, developed severe RPE/photoreceptor dystrophy at an early age", "evidence": [ { "database": "RefSeq", "id": "NP_001025461", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025461" }, { "database": "PubMed", "id": "18658157", "url": "https://glygen.org/publication/PubMed/18658157" } ] }, { "annotation": "PrRDH is an enzyme that catalyzes reduction of all-trans-retinal in the rod outer segment, most noticeably at higher light intensities and prolonged illumination, but is not an essential enzyme of the retinoid cycle", "evidence": [ { "database": "RefSeq", "id": "NP_001025461", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025461" }, { "database": "PubMed", "id": "15755727", "url": "https://glygen.org/publication/PubMed/15755727" } ] }, { "annotation": "Retinol dehydrogenase with a clear preference for NADP. Converts all-trans-retinal to all-trans-retinol. May play a role in the regeneration of visual pigment at high light intensity.", "evidence": [ { "database": "UniProtKB", "id": "D3Z6W3", "url": "https://www.uniprot.org/uniprot/D3Z6W3#function" }, { "database": "UniProtKB", "id": "PIRNR000095", "url": "https://www.uniprot.org/uniprot/PIRNR000095#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "D3Z6W3", "url": "https://www.uniprot.org/uniprot/D3Z6W3" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Rdh8", "url": "https://www.uniprot.org/uniprot/D3Z6W3", "locus": { "chromosome": "9", "start_pos": 20737413, "end_pos": 20729799, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000053773", "url": "https://www.ensembl.org/id/ENSMUSG00000053773" } ] } } ], "crossref": [ { "id": "ENSMUSG00000053773", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000053773", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "1.1.1.300", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.1.1.300&UniProtAcc=D3Z6W3", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "235033", "url": "https://www.ncbi.nlm.nih.gov/gene/235033", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002347", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002347", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011348", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011348", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020904", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020904", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036291", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036291", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:235033", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:235033", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2685028", "url": "http://www.informatics.jax.org/marker/MGI:2685028", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "LACGCLP", "url": "https://omabrowser.org/oma/group/LACGCLP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2898074at2759", "url": "http://www.orthodb.org/?query=2898074at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43391", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43391", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43391:SF8", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43391:SF8", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00106", "url": "http://pfam.xfam.org/family/PF00106", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001025461", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025461", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "25033", "url": "https://www.rhea-db.org/rhea/25033", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "D3Z6W3", "url": "https://www.uniprot.org/uniprot/D3Z6W3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z6W3-1", "url": "https://www.uniprot.org/uniprot/D3Z6W3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASQQRTVLISGCSSGIGLELALQLAHDPRQRYQVVATMRDLGKKEPLEAAAGEALGKTLSVVQLDVCNDESVTDCLSHIEGGQVDVLVNNAGVGLVGPLEGLSLATMQSVFNTNFFGAVRLVKAVLPGMKRRRQGHIVVVSSVMGLQGVMFNDVYAASKFALEGFFESLAIQLRQFNIFISMVEPGPVTTDFEGKLLAQVSKAEFPDTDPDTLGYFRDLYLPASRELFRSVGQSPRDVAQVIAKVIGTTRPPLRRQTNTRYLPLTALKAMDPSGSLYVKTAHRLLFRWPHLLNLGLRCLACGCLPTRVWPRQTEQN", "length": 317, "header": "tr|D3Z6W3-1|D3Z6W3_MOUSE Isoform 1 of Retinol dehydrogenase OS=Mus musculus OX=10090 GN=Rdh8 PE=3 SV=1 CANONICAL=D3Z6W3-1" }, "isoforms": [ { "isoform_ac": "D3Z6W3-1", "url": "", "sequence": { "sequence": "MASQQRTVLISGCSSGIGLELALQLAHDPRQRYQVVATMRDLGKKEPLEAAAGEALGKTLSVVQLDVCNDESVTDCLSHIEGGQVDVLVNNAGVGLVGPLEGLSLATMQSVFNTNFFGAVRLVKAVLPGMKRRRQGHIVVVSSVMGLQGVMFNDVYAASKFALEGFFESLAIQLRQFNIFISMVEPGPVTTDFEGKLLAQVSKAEFPDTDPDTLGYFRDLYLPASRELFRSVGQSPRDVAQVIAKVIGTTRPPLRRQTNTRYLPLTALKAMDPSGSLYVKTAHRLLFRWPHLLNLGLRCLACGCLPTRVWPRQTEQN", "length": 317, "header": "tr|D3Z6W3-1|D3Z6W3_MOUSE Isoform 1 of Retinol dehydrogenase OS=Mus musculus OX=10090 GN=Rdh8 PE=3 SV=1 CANONICAL=D3Z6W3-1" }, "locus": { "chromosome": "9", "start_pos": 20736960, "end_pos": 20729800, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000066387.6", "url": "https://www.ensembl.org/id/ENSMUST00000066387.6" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000067662.5", "url": "https://www.ensembl.org/id/ENSMUSP00000067662.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Role of photoreceptor-specific retinol dehydrogenase in the retinoid cycle in vivo.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Maeda A, Maeda T, Imanishi Y, Kuksa V, Alekseev A, Bronson JD, Zhang H, Zhu L, Sun W, Saperstein DA, Rieke F, Baehr W, Palczewski K", "evidence": [ { "database": "RefSeq", "id": "NP_001025461", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025461" } ], "reference": [ { "type": "PubMed", "id": "15755727", "url": "https://glygen.org/publication/PubMed/15755727" } ] }, { "title": "Retinopathy in mice induced by disrupted all-trans-retinal clearance.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Maeda A, Maeda T, Golczak M, Palczewski K", "evidence": [ { "database": "RefSeq", "id": "NP_001025461", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025461" } ], "reference": [ { "type": "PubMed", "id": "18658157", "url": "https://glygen.org/publication/PubMed/18658157" } ] } ], "pathway": [ { "id": "mmu:235033", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:235033", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D4A8D2-1", "protein_name": "Retinol dehydrogenase", "gene_name": "Rdh8", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MASQPQRVLISGCSSGIGLELAVQLAHDPRQRYQVVATMRDLGKKEPLEAAAGEALGKTLSVAQLDVCSDESVTNCLSHIEGGQVDILVNNAGVGLVGPLEDLSLATMQNVFNTNFFGAVRLVKAVLPGMKRRRQGHIVVVSSVMGLQGVMFNDVYAASKFALEGFFESLAIQLRQFNIFISMVEPGPVITDFEGKLLAQVSKTEFPDTDPETLGYFRDLYLPASRELFRSVGQSPRDVAQVIAKVIGSTRPPLRRQTNARYFPLTALKALDPSGSLYVRTTHRLLFRWPHLLSLGLRCLACGCLPTRVGPT", "length": 312 }, "evidence": [ { "id": "45225690", "url": "http://www.informatics.jax.org/homology/45225690", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9NYR8-1", "protein_name": "Retinol dehydrogenase 8", "gene_name": "RDH8", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAAAPRTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLGKKETLEAAAGEALGQTLTVAQLDVCSDESVAQCLSCIQGEVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASKFALEGFFESLAIQLLQFNIFISLVEPGPVVTEFEGKLLAQVSMAEFPGTDPETLHYFRDLYLPASRKLFCSVGQNPQDVVQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCLSCGCLPTRVRPR", "length": 311 }, "evidence": [ { "id": "45225690", "url": "http://www.informatics.jax.org/homology/45225690", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "D3Z6W3", "url": "https://www.uniprot.org/uniprot/D3Z6W3" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "D3Z6W3", "url": "https://www.uniprot.org/uniprot/D3Z6W3" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "NAD-retinol dehydrogenase activity", "id": "GO:0004745", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004745", "evidence": [ { "database": "UniProtKB", "id": "D3Z6W3", "url": "https://www.uniprot.org/uniprot/D3Z6W3" } ], "pmid": "" }, { "name": "estradiol 17-beta-dehydrogenase [NAD(P)] activity", "id": "GO:0004303", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004303", "evidence": [ { "database": "UniProtKB", "id": "D3Z6W3", "url": "https://www.uniprot.org/uniprot/D3Z6W3" } ], "pmid": "" }, { "name": "NADP-retinol dehydrogenase activity", "id": "GO:0052650", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052650", "evidence": [ { "database": "UniProtKB", "id": "D3Z6W3", "url": "https://www.uniprot.org/uniprot/D3Z6W3" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "retinol metabolic process", "id": "GO:0042572", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042572", "evidence": [ { "database": "UniProtKB", "id": "D3Z6W3", "url": "https://www.uniprot.org/uniprot/D3Z6W3" } ], "pmid": "" }, { "name": "visual perception", "id": "GO:0007601", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007601", "evidence": [ { "database": "UniProtKB", "id": "D3Z6W3", "url": "https://www.uniprot.org/uniprot/D3Z6W3" } ], "pmid": "" }, { "name": "estrogen biosynthetic process", "id": "GO:0006703", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006703", "evidence": [ { "database": "UniProtKB", "id": "D3Z6W3", "url": "https://www.uniprot.org/uniprot/D3Z6W3" } ], "pmid": "" }, { "name": "response to stimulus", "id": "GO:0050896", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050896", "evidence": [ { "database": "UniProtKB", "id": "D3Z6W3", "url": "https://www.uniprot.org/uniprot/D3Z6W3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "25033", "name": "", "equation": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q80ZF7-1", "P07943-1", "D4A8D2-1", "Q8VID1-1", "C9JRZ8-1", "O60218-1", "P15121-1", "O75911-1", "Q9NYR8-1", "Q96NR8-1", "Q9HBH5-1", "Q8TC12-1", "Q8IZV5-1", "Q8NBN7-1", "Q9Y394-1", "Q8VCH7-1", "P45376-1", "O88876-1", "Q8CEE7-1", "Q9ERI6-1", "Q8BYK4-1", "Q9QYF1-1", "D3Z6W3-1", "Q99LB2-1", "Q9CXR1-1" ], "evidence": [ { "id": "25033", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/25033" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "C9JRZ8", "gene_name": "AKR1B15", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "C9JRZ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9JRZ8" } ] }, { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "C9JRZ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9JRZ8" } ] }, { "ec_number": "1.1.1.64", "activity": "NADP(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADPH.", "evidence": [ { "id": "C9JRZ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9JRZ8" } ] }, { "ec_number": "1.1.1.54", "activity": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH.", "evidence": [ { "id": "C9JRZ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9JRZ8" } ] }, { "ec_number": "1.1.1.216", "activity": "(2E,6E)-farnesol + NADP(+) = (2E,6E)-farnesal + H(+) + NADPH.", "evidence": [ { "id": "C9JRZ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9JRZ8" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "C9JRZ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9JRZ8" } ] }, { "ec_number": "1.1.1.54", "activity": "", "evidence": [ { "id": "C9JRZ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9JRZ8" } ] } ] }, { "uniprot_ac": "D3Z6W3", "gene_name": "Rdh8", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "D3Z6W3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z6W3" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "D3Z6W3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z6W3" } ] } ] }, { "uniprot_ac": "D4A8D2", "gene_name": "Rdh8", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "D4A8D2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A8D2" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "D4A8D2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A8D2" } ] } ] }, { "uniprot_ac": "O60218", "gene_name": "AKR1B10", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "O60218", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60218" } ] }, { "ec_number": "1.1.1.54", "activity": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH.", "evidence": [ { "id": "O60218", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60218" } ] }, { "ec_number": "1.1.1.54", "activity": "", "evidence": [ { "id": "O60218", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60218" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "O60218", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60218" } ] } ] }, { "uniprot_ac": "O75911", "gene_name": "DHRS3", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "O75911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75911" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "O75911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75911" } ] } ] }, { "uniprot_ac": "O88876", "gene_name": "Dhrs3", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "O88876", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88876" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "O88876", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88876" } ] } ] }, { "uniprot_ac": "P07943", "gene_name": "Akr1b1", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "P07943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07943" } ] }, { "ec_number": "1.1.1.21", "activity": "an alditol + NADP(+) = an aldose + H(+) + NADPH.", "evidence": [ { "id": "P07943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07943" } ] }, { "ec_number": "1.1.1.372", "activity": "glycerol + NADP(+) = H(+) + L-glyceraldehyde + NADPH.", "evidence": [ { "id": "P07943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07943" } ] }, { "ec_number": "1.1.1.54", "activity": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH.", "evidence": [ { "id": "P07943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07943" } ] }, { "ec_number": "1.1.1.372", "activity": "", "evidence": [ { "id": "P07943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07943" } ] }, { "ec_number": "1.1.1.21", "activity": "", "evidence": [ { "id": "P07943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07943" } ] }, { "ec_number": "1.1.1.54", "activity": "", "evidence": [ { "id": "P07943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07943" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "P07943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07943" } ] } ] }, { "uniprot_ac": "P15121", "gene_name": "AKR1B1", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "P15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15121" } ] }, { "ec_number": "1.1.1.21", "activity": "an alditol + NADP(+) = an aldose + H(+) + NADPH.", "evidence": [ { "id": "P15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15121" } ] }, { "ec_number": "1.1.1.372", "activity": "glycerol + NADP(+) = H(+) + L-glyceraldehyde + NADPH.", "evidence": [ { "id": "P15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15121" } ] }, { "ec_number": "1.1.1.54", "activity": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH.", "evidence": [ { "id": "P15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15121" } ] }, { "ec_number": "1.1.1.372", "activity": "", "evidence": [ { "id": "P15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15121" } ] }, { "ec_number": "1.1.1.54", "activity": "", "evidence": [ { "id": "P15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15121" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "P15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15121" } ] } ] }, { "uniprot_ac": "P45376", "gene_name": "Akr1b1", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "P45376", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45376" } ] }, { "ec_number": "1.1.1.21", "activity": "an alditol + NADP(+) = an aldose + H(+) + NADPH.", "evidence": [ { "id": "P45376", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45376" } ] }, { "ec_number": "1.1.1.372", "activity": "glycerol + NADP(+) = H(+) + L-glyceraldehyde + NADPH.", "evidence": [ { "id": "P45376", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45376" } ] }, { "ec_number": "1.1.1.54", "activity": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH.", "evidence": [ { "id": "P45376", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45376" } ] }, { "ec_number": "1.1.1.372", "activity": "", "evidence": [ { "id": "P45376", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45376" } ] }, { "ec_number": "1.1.1.54", "activity": "", "evidence": [ { "id": "P45376", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45376" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "P45376", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45376" } ] } ] }, { "uniprot_ac": "Q80ZF7", "gene_name": "Rdh10", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q80ZF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZF7" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q80ZF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZF7" } ] } ] }, { "uniprot_ac": "Q8BYK4", "gene_name": "Rdh12", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q8BYK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BYK4" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q8BYK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BYK4" } ] } ] }, { "uniprot_ac": "Q8CEE7", "gene_name": "Rdh13", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q8CEE7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CEE7" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q8CEE7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CEE7" } ] } ] }, { "uniprot_ac": "Q8IZV5", "gene_name": "RDH10", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q8IZV5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IZV5" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q8IZV5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IZV5" } ] } ] }, { "uniprot_ac": "Q8NBN7", "gene_name": "RDH13", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q8NBN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NBN7" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q8NBN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NBN7" } ] } ] }, { "uniprot_ac": "Q8TC12", "gene_name": "RDH11", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q8TC12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TC12" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q8TC12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TC12" } ] } ] }, { "uniprot_ac": "Q8VCH7", "gene_name": "Rdh10", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q8VCH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCH7" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q8VCH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCH7" } ] } ] }, { "uniprot_ac": "Q8VID1", "gene_name": "Dhrs4", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] }, { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] } ] }, { "uniprot_ac": "Q96NR8", "gene_name": "RDH12", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q96NR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96NR8" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q96NR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96NR8" } ] } ] }, { "uniprot_ac": "Q99LB2", "gene_name": "Dhrs4", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q99LB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LB2" } ] }, { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "Q99LB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LB2" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "Q99LB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LB2" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q99LB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LB2" } ] } ] }, { "uniprot_ac": "Q9CXR1", "gene_name": "Dhrs7", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "Q9CXR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CXR1" } ] } ] }, { "uniprot_ac": "Q9ERI6", "gene_name": "Rdh14", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q9ERI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERI6" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q9ERI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERI6" } ] } ] }, { "uniprot_ac": "Q9HBH5", "gene_name": "RDH14", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q9HBH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBH5" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q9HBH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBH5" } ] } ] }, { "uniprot_ac": "Q9NYR8", "gene_name": "RDH8", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q9NYR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYR8" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q9NYR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYR8" } ] } ] }, { "uniprot_ac": "Q9QYF1", "gene_name": "Rdh11", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q9QYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYF1" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q9QYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYF1" } ] } ] }, { "uniprot_ac": "Q9Y394", "gene_name": "DHRS7", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "Q9Y394", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y394" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }