{ "uniprot_canonical_ac": "B2RZ42-1", "uniprot_ac": "B2RZ42", "uniprot_id": "ALKL2_RAT", "mass": { "chemical_mass": 17428.0, "monoisotopic_mass": 17428.0 }, "refseq": {}, "gene_names": [ { "name": "Alkal2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/B2RZ42", "id": "B2RZ42" } ], "protein_names": [ { "name": "ALK and LTK ligand 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "B2RZ42" } ], "function": [ { "annotation": "Cytokine that acts as a physiological ligand for receptor tyrosine kinases LTK and ALK, leading to their activation. Cytokine-binding is sufficient to activate LTK. In contrast, ALKAL2-driven activation of ALK is coupled with heparin-binding to ALK. Stimulation of ALK signaling is involved in neural development and regulation of energy expenditure.", "evidence": [ { "database": "UniProtKB", "id": "B2RZ42", "url": "https://www.uniprot.org/uniprot/B2RZ42#function" }, { "database": "UniProtKB", "id": "Q6UX46", "url": "https://www.uniprot.org/uniprot/Q6UX46#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "B2RZ42", "url": "https://www.uniprot.org/uniprot/B2RZ42" } ], "common_name": "Rat" } ], "gene": [ { "name": "Alkal2", "url": "https://www.uniprot.org/uniprot/B2RZ42", "locus": { "chromosome": "6", "start_pos": 47505234, "end_pos": 47495782, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000005154", "url": "https://www.ensembl.org/id/ENSRNOG00000005154" } ] } } ], "crossref": [ { "id": "ENSRNOG00000005154", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000005154", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR029364", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029364", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:679566", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:679566", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "KHDYTLG", "url": "https://omabrowser.org/oma/group/KHDYTLG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5342509at2759", "url": "http://www.orthodb.org/?query=5342509at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR28676", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28676", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR28676:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28676:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15129", "url": "http://pfam.xfam.org/family/PF15129", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_B2RZ42", "url": "http://purl.obolibrary.org/obo/PR_B2RZ42", "database": "PRO", "categories": [ "Protein" ] }, { "id": "1587117", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1587117", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "B2RZ42", "url": "https://www.uniprot.org/uniprot/B2RZ42", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B2RZ42-1", "url": "https://www.uniprot.org/uniprot/B2RZ42-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRVSGRPMLLALLLLLSTVGDPGHAQPRGPADRQTLLRLLVELVQELKKFHIGDSKRLQLLGESDFALGRREATDYGADQEEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPMCMER", "length": 151, "header": "sp|B2RZ42-1|ALKL2_RAT Isoform 1 of ALK and LTK ligand 2 OS=Rattus norvegicus OX=10116 GN=Alkal2 PE=2 SV=1 CANONICAL=B2RZ42-1" }, "isoforms": [ { "isoform_ac": "B2RZ42-1", "url": "", "sequence": { "sequence": "MRVSGRPMLLALLLLLSTVGDPGHAQPRGPADRQTLLRLLVELVQELKKFHIGDSKRLQLLGESDFALGRREATDYGADQEEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPMCMER", "length": 151, "header": "sp|B2RZ42-1|ALKL2_RAT Isoform 1 of ALK and LTK ligand 2 OS=Rattus norvegicus OX=10116 GN=Alkal2 PE=2 SV=1 CANONICAL=B2RZ42-1" }, "locus": { "chromosome": "6", "start_pos": 47501439, "end_pos": 47496262, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000006921", "url": "https://www.ensembl.org/id/ENSRNOT00000006921" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000006921", "url": "https://www.ensembl.org/id/ENSRNOP00000006921" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:679566", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:679566", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q6UX46-1", "protein_name": "ALK and LTK ligand 2", "gene_name": "ALKAL2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRGPGHPLLLGLLLVLGAAGRGRGGAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGRAEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ", "length": 152 }, "evidence": [ { "id": "B2RZ42", "url": "https://omabrowser.org/oma/group/B2RZ42/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q80UG6-1", "protein_name": "ALK and LTK ligand 2", "gene_name": "Alkal2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRVSGRPMLLALLLLLSTVGDRGRAQSRGPADRQTLLRLLVELVQELKKFHIGDSKRLQLLGESDFALGRREATDYGADQEEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPMCMER", "length": 151 }, "evidence": [ { "id": "B2RZ42", "url": "https://omabrowser.org/oma/group/B2RZ42/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "B2RZ42", "url": "https://www.uniprot.org/uniprot/B2RZ42" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "B2RZ42", "url": "https://www.uniprot.org/uniprot/B2RZ42" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "B2RZ42", "url": "https://www.uniprot.org/uniprot/B2RZ42" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "transmembrane receptor protein tyrosine kinase signaling pathway", "id": "GO:0007169", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007169", "evidence": [ { "database": "UniProtKB", "id": "B2RZ42", "url": "https://www.uniprot.org/uniprot/B2RZ42" } ], "pmid": "" }, { "name": "positive regulation of neuron projection development", "id": "GO:0010976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010976", "evidence": [ { "database": "UniProtKB", "id": "B2RZ42", "url": "https://www.uniprot.org/uniprot/B2RZ42" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "B2RZ42", "url": "https://www.uniprot.org/uniprot/B2RZ42" } ], "pmid": "" }, { "name": "positive regulation of ERK5 cascade", "id": "GO:0070378", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070378", "evidence": [ { "database": "UniProtKB", "id": "B2RZ42", "url": "https://www.uniprot.org/uniprot/B2RZ42" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "cytokine activity", "id": "GO:0005125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125", "evidence": [ { "database": "UniProtKB", "id": "B2RZ42", "url": "https://www.uniprot.org/uniprot/B2RZ42" } ], "pmid": "" }, { "name": "receptor tyrosine kinase binding", "id": "GO:0030971", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030971", "evidence": [ { "database": "UniProtKB", "id": "B2RZ42", "url": "https://www.uniprot.org/uniprot/B2RZ42" } ], "pmid": "" }, { "name": "receptor signaling protein tyrosine kinase activator activity", "id": "GO:0030298", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030298", "evidence": [ { "database": "UniProtKB", "id": "B2RZ42", "url": "https://www.uniprot.org/uniprot/B2RZ42" } ], "pmid": "" }, { "name": "transmembrane receptor protein tyrosine kinase activator activity", "id": "GO:0030297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030297", "evidence": [ { "database": "UniProtKB", "id": "B2RZ42", "url": "https://www.uniprot.org/uniprot/B2RZ42" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }