{ "uniprot_canonical_ac": "B2RWW0-1", "uniprot_ac": "B2RWW0", "uniprot_id": "TAGAP_MOUSE", "mass": { "chemical_mass": 78920.0, "monoisotopic_mass": 78920.0 }, "refseq": { "ac": "NP_666080", "name": "T-cell activation Rho GTPase-activating protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666080" }, "gene_names": [ { "name": "Tagap", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/B2RWW0", "id": "B2RWW0" }, { "name": "2610315E15Rik; Tcd-1; Tcd1; Tcd1a; tcs-1; tcs1; TRD", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666080", "id": "NP_666080" }, { "name": "Tagap", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666080", "id": "NP_666080" } ], "protein_names": [ { "name": "T-cell activation Rho GTPase-activating protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "B2RWW0" }, { "name": "T-cell activation GTPase-activating protein 1; t-complex distorter 1A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666080", "id": "NP_666080" }, { "name": "T-cell activation GTPase-activating protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "B2RWW0" }, { "name": "T-cell activation Rho GTPase-activating protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666080", "id": "NP_666080" } ], "function": [ { "annotation": "Loss of Tagap in mice suppressed the sema3E- and plexin-D1-mediated release of thymocytes that adhered within the cortex through beta1-containing integrins. This suppression led to the impaired translocation of thymocytes from the cortex to the medulla and resulted in the formation of ectopic medullary structures within the thymic cortex leading to autoimmune disorders. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_666080", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666080" }, { "database": "PubMed", "id": "29895617", "url": "https://glygen.org/publication/PubMed/29895617" } ] }, { "annotation": "May function as a GTPase-activating protein. May play a role in transmission ratio distortion (TRD) in mouse, in which heterozygous males for t-locus transmit their t-carrying chromosome to 95% or more of their offspring.", "evidence": [ { "database": "UniProtKB", "id": "B2RWW0", "url": "https://www.uniprot.org/uniprot/B2RWW0#function" }, { "database": "PubMed", "id": "16116428", "url": "https://glygen.org/publication/PubMed/16116428" } ] }, { "annotation": "TAGAP instructs Th17 differentiation by bridging Dectin activation to EPHB2 signaling in innate antifungal response. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_666080", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666080" }, { "database": "PubMed", "id": "32312989", "url": "https://glygen.org/publication/PubMed/32312989" } ] }, { "annotation": "These findings indicate that increased TAGAP expression is a distinguishing feature of inflammatory disease and further highlight the role of TAGAP in rheumatoid arthritis susceptibility.", "evidence": [ { "database": "RefSeq", "id": "NP_666080", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666080" }, { "database": "PubMed", "id": "29017772", "url": "https://glygen.org/publication/PubMed/29017772" } ] }, { "annotation": "These studies demonstrated that TAGAP was required for TH17 differentiation in vitro and that the loss of TAGAP in mice ameliorated the clinical features of experimental autoimmune encephalomyelitis, indicating that TAGAP is critical for disease progression", "evidence": [ { "database": "RefSeq", "id": "NP_666080", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666080" }, { "database": "PubMed", "id": "28462950", "url": "https://glygen.org/publication/PubMed/28462950" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs3389400472", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389400472" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 315, "end_pos": 315, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDP->NDS).", "chr_id": "17", "chr_pos": "8151759", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P315", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs578344742", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs578344742" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 578, "end_pos": 578, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DNT->NNT).", "chr_id": "17", "chr_pos": "8152548", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D578", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "B2RWW0", "url": "https://www.uniprot.org/uniprot/B2RWW0" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Tagap", "url": "https://www.uniprot.org/uniprot/B2RWW0", "locus": { "chromosome": "17", "start_pos": 8153729, "end_pos": 8144832, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000033450", "url": "https://www.ensembl.org/id/ENSMUSG00000033450" } ] } } ], "crossref": [ { "id": "ENSMUSG00000033450", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000033450", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd04402", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04402", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "72536", "url": "https://www.ncbi.nlm.nih.gov/gene/72536", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "B2RWW0", "url": "https://www.ebi.ac.uk/intact/interactors/id:B2RWW0*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000198", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000198", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008936", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008936", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:72536", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:72536", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "3615484", "url": "http://www.informatics.jax.org/marker/MGI:3615484", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "B2RWW0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=B2RWW0", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "FEEWMDA", "url": "https://omabrowser.org/oma/group/FEEWMDA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2964977at2759", "url": "http://www.orthodb.org/?query=2964977at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23179", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23179", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23179:SF26", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23179:SF26", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00620", "url": "http://pfam.xfam.org/family/PF00620", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_B2RWW0", "url": "http://purl.obolibrary.org/obo/PR_B2RWW0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8980692", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9013148", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9013149", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_666080", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666080", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B2RWW0", "url": "https://www.uniprot.org/uniprot/B2RWW0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B2RWW0-1", "url": "https://www.uniprot.org/uniprot/B2RWW0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKLISSLDGSKTLNANNMETLIECQSEGDIKVPPLLTSCESEDSICQLTEIKKRKKVLSWPSLMRKLSPSSDFSGSLEPELKVSLFDQPLSIICGENDTLPRPIQDILTILCLKGPSTEGIFRKAASEKARKELKEGLNCGVSVNLKQLPVHLLAVVFKDFLRGIPLKLLSCDLFEDWMGALEKPTEEDRIEALKQVAGGLPRPNLLLLRHLLYVLHLISKNAEVNKMDSSNLAICIGPNMLTLKNDQSLSFQAQKDLNNKVKILVEFLIDNCFEIFGENIRTRSRITSDDSLEHTDSSDVSTLQNDSAYDSNDPDVEPTSGAASPNRQLEGPTPTMAGLDTRGQRDTCESSSESSVSMVVRLKSSIVQQDRRFSEPNMSPSRECLVGPTSKQKLARSEDSFTLSQDASCSEGDEAEDPFTEEVFPAVDSKPKRPVDLKIKNWTQGLASPQGHITKAFSRSSPGESLGSSPVPSPSCPKRNFFTRHQSFTTKTDKTKPQREIRKHSMSFSFASHKKVLPRTSSIGSEKSKDFSRDQLQKDLRKESQLSGRIVQENESEIQSQTSLGFSLSGTWALSVDNTFQLVDMRKPGSPPSYEEAIYYQTSGLTAYGGQTVGSMRSRMFKPSTAVPPVPSHHGGDLSEGTPGGHRLSSVTEHWTHSQTVHVSIETQGRSELHQLRTVSESMQKAKLDCLGPQHSHLVFEADQLCCARESYI", "length": 714, "header": "sp|B2RWW0-1|TAGAP_MOUSE Isoform 1 of T-cell activation Rho GTPase-activating protein OS=Mus musculus OX=10090 GN=Tagap PE=2 SV=2 CANONICAL=B2RWW0-1" }, "isoforms": [ { "isoform_ac": "B2RWW0-1", "url": "", "sequence": { "sequence": "MKLISSLDGSKTLNANNMETLIECQSEGDIKVPPLLTSCESEDSICQLTEIKKRKKVLSWPSLMRKLSPSSDFSGSLEPELKVSLFDQPLSIICGENDTLPRPIQDILTILCLKGPSTEGIFRKAASEKARKELKEGLNCGVSVNLKQLPVHLLAVVFKDFLRGIPLKLLSCDLFEDWMGALEKPTEEDRIEALKQVAGGLPRPNLLLLRHLLYVLHLISKNAEVNKMDSSNLAICIGPNMLTLKNDQSLSFQAQKDLNNKVKILVEFLIDNCFEIFGENIRTRSRITSDDSLEHTDSSDVSTLQNDSAYDSNDPDVEPTSGAASPNRQLEGPTPTMAGLDTRGQRDTCESSSESSVSMVVRLKSSIVQQDRRFSEPNMSPSRECLVGPTSKQKLARSEDSFTLSQDASCSEGDEAEDPFTEEVFPAVDSKPKRPVDLKIKNWTQGLASPQGHITKAFSRSSPGESLGSSPVPSPSCPKRNFFTRHQSFTTKTDKTKPQREIRKHSMSFSFASHKKVLPRTSSIGSEKSKDFSRDQLQKDLRKESQLSGRIVQENESEIQSQTSLGFSLSGTWALSVDNTFQLVDMRKPGSPPSYEEAIYYQTSGLTAYGGQTVGSMRSRMFKPSTAVPPVPSHHGGDLSEGTPGGHRLSSVTEHWTHSQTVHVSIETQGRSELHQLRTVSESMQKAKLDCLGPQHSHLVFEADQLCCARESYI", "length": 714, "header": "sp|B2RWW0-1|TAGAP_MOUSE Isoform 1 of T-cell activation Rho GTPase-activating protein OS=Mus musculus OX=10090 GN=Tagap PE=2 SV=2 CANONICAL=B2RWW0-1" }, "locus": { "chromosome": "17", "start_pos": 8152958, "end_pos": 8145742, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000036370", "url": "https://www.ensembl.org/id/ENSMUST00000036370" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000047431", "url": "https://www.ensembl.org/id/ENSMUSP00000047431" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 533, "start_aa": "Ser", "end_pos": 533, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser533", "evidence": [ { "id": "B2RWW0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=B2RWW0" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" } ] } ], "phosphorylation": [ { "start_pos": 310, "end_pos": 310, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "B2RWW0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/B2RWW0" }, { "database": "PubMed", "id": "32312989", "url": "https://glygen.org/publication/PubMed/32312989" } ], "site_lbl": "Tyr310" }, { "start_pos": 398, "end_pos": 398, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "B2RWW0", "url": "https://www.uniprot.org/uniprot/B2RWW0" } ], "site_lbl": "Ser398" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "The t complex-encoded GTPase-activating protein Tagap1 acts as a transmission ratio distorter in mice.", "journal": "Nat. Genet.", "date": "2005", "authors": "Bauer H, Willert J, Koschorz B, Herrmann BG", "evidence": [ { "database": "UniProtKB", "id": "B2RWW0", "url": "https://www.uniprot.org/uniprot/B2RWW0" } ], "reference": [ { "type": "PubMed", "id": "16116428", "url": "https://glygen.org/publication/PubMed/16116428" } ] }, { "title": "T-cell activation RhoGTPase-activating protein plays an important role in TH17-cell differentiation.", "journal": "Immunology and cell biology", "date": "2017", "authors": "Tamehiro N, Nishida K, Yanobu-Takanashi R, Goto M, Okamura T, Suzuki H", "evidence": [ { "database": "RefSeq", "id": "NP_666080", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666080" } ], "reference": [ { "type": "PubMed", "id": "28462950", "url": "https://glygen.org/publication/PubMed/28462950" } ] }, { "title": "T cell activation Rho GTPase activating protein (TAGAP) is upregulated in clinical and experimental arthritis.", "journal": "Cytokine", "date": "2018", "authors": "Arshad M, Bhatti A, John P, Jalil F, Borghese F, Kawalkowska JZ, Williams RO, Clanchy FIL", "evidence": [ { "database": "RefSeq", "id": "NP_666080", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666080" } ], "reference": [ { "type": "PubMed", "id": "29017772", "url": "https://glygen.org/publication/PubMed/29017772" } ] }, { "title": "Regulation of thymocyte trafficking by Tagap, a GAP domain protein linked to human autoimmunity.", "journal": "Science signaling", "date": "2018", "authors": "Duke-Cohan JS, Ishikawa Y, Yoshizawa A, Choi YI, Lee CN, Acuto O, Kissler S, Reinherz EL", "evidence": [ { "database": "RefSeq", "id": "NP_666080", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666080" } ], "reference": [ { "type": "PubMed", "id": "29895617", "url": "https://glygen.org/publication/PubMed/29895617" } ] }, { "title": "Quantitative Profiling of Protein O-GlcNAcylation Sites by an Isotope-Tagged Cleavable Linker.", "journal": "ACS chemical biology", "date": "2018", "authors": "Qin K, Zhu Y, Qin W, Gao J, Shao X, Wang YL, Zhou W, Wang C, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "B2RWW0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=B2RWW0" } ], "reference": [ { "type": "PubMed", "id": "30059200", "url": "https://glygen.org/publication/PubMed/30059200" } ] }, { "title": "TAGAP instructs Th17 differentiation by bridging Dectin activation to EPHB2 signaling in innate antifungal response.", "journal": "Nature communications", "date": "2020", "authors": "Chen J, He R, Sun W, Gao R, Peng Q, Zhu L, Du Y, Ma X, Guo X, Zhang H, Tan C, Wang J, Zhang W, Weng X, Man J, Bauer H, Wang QK, Martin BN, Zhang CJ, Li X, Wang C", "evidence": [ { "database": "RefSeq", "id": "NP_666080", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666080" }, { "database": "iPTMnet", "id": "B2RWW0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/B2RWW0" } ], "reference": [ { "type": "PubMed", "id": "32312989", "url": "https://glygen.org/publication/PubMed/32312989" } ] } ], "pathway": [ { "id": "mmu:72536", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:72536", "resource": "KEGG Pathway" }, { "id": "R-MMU-8980692", "name": "RHOA GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8980692", "resource": "Reactome", "description": "RHOA GTPase cycle" }, { "id": "R-MMU-9013148", "name": "CDC42 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9013148", "resource": "Reactome", "description": "CDC42 GTPase cycle" }, { "id": "R-MMU-9013149", "name": "RAC1 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9013149", "resource": "Reactome", "description": "RAC1 GTPase cycle" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZXG5-1", "protein_name": "T-cell activation RhoGTPase activating protein", "gene_name": "Tagap", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKLISSLDGAKTLNANNMDTLIECQSEGDIKVLPLLTSCESEDSICQLIEVKKRKKVLSWPSLMRKLSPSPDFSGSLEPELKVSLFDQPLSIICKENDTLPRPIQDILTILCLKGPSTEGIFRKAASEKARKELKEELNCGGSVNLNQLPVHLLAVVFKDFLRGIPLKLLSCDLFEDWMGALEKPSEEDRIEALKQVADRLPRPNLLLLRTLVYVLHLISKNAEVNKMDSSNLAICIGPNMLTLKNDQSLSFQAQRDLNNKVKILVEFLIDNCLEIFGENIPTHPRITSDDSLEHTDSSDVSTLQNDSAYDSNDPDVEPANGVASPCRQLEGPSTTVAGMDTRGPRNTCESSSESSVSMVARLKSSIGQQDRRFSEPNMPPSRECFVGPITKQKLTRSEDSFVLPQEASCSEGNEAEDPFTEEVFPAVEGKPMRPVDLKIKNLTQGLASPQGPANKAFSSFSAGESLDSSPVPSPSCPKRNFFTRHQSFTTKTDKTKPQREIRKHSMSFSFASHKKVLPRTSSIGSEKSKDFSRDQLQKDLRKESQLAGRIIRENESEIQSQTNLGSSLSGTWALSVDNTFQFIDVRKPGSPPSYEEAIYYHTSGLTAYSGQTVGSMRARMLKQSMAVPPVPSHHEGELSEGIPGGHRSSSVTEHWTQSQTVHVSVETRGRSELHRLRTVSESVQRAKLDYLGQQRSHLVFEVDQLRCAKESYI", "length": 714 }, "evidence": [ { "id": "45232973", "url": "http://www.informatics.jax.org/homology/45232973", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8N103-1", "protein_name": "T-cell activation Rho GTPase-activating protein", "gene_name": "TAGAP", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKLRSSHNASKTLNANNMETLIECQSEGDIKEHPLLASCESEDSICQLIEVKKRKKVLSWPFLMRRLSPASDFSGALETDLKASLFDQPLSIICGDSDTLPRPIQDILTILCLKGPSTEGIFRRAANEKARKELKEELNSGDAVDLERLPVHLLAVVFKDFLRSIPRKLLSSDLFEEWMGALEMQDEEDRIEALKQVADKLPRPNLLLLKHLVYVLHLISKNSEVNRMDSSNLAICIGPNMLTLENDQSLSFEAQKDLNNKVKTLVEFLIDNCFEIFGENIPVHSSITSDDSLEHTDSSDVSTLQNDSAYDSNDPDVESNSSSGISSPSRQPQVPMATAAGLDSAGPQDAREVSPEPIVSTVARLKSSLAQPDRRYSEPSMPSSQECLESRVTNQTLTKSEGDFPVPRVGSRLESEEAEDPFPEEVFPAVQGKTKRPVDLKIKNLAPGSVLPRALVLKAFSSSSLDASSDSSPVASPSSPKRNFFSRHQSFTTKTEKGKPSREIKKHSMSFTFAPHKKVLTKNLSAGSGKSQDFTRDHVPRGVRKESQLAGRIVQENGCETHNQTARGFCLRPHALSVDDVFQGADWERPGSPPSYEEAMQGPAARLVASESQTVGSMTVGSMRARMLEAHCLLPPLPPAHHVEDSRHRGSKEPLPGHGLSPLPERWKQSRTVHASGDSLGHVSGPGRPELLPLRTVSESVQRNKRDCLVRRCSQPVFEADQFQYAKESYI", "length": 731 }, "evidence": [ { "id": "45232973", "url": "http://www.informatics.jax.org/homology/45232973", "database": "MGI" }, { "id": "B2RWW0", "url": "https://omabrowser.org/oma/group/B2RWW0/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "GTPase activator activity", "id": "GO:0005096", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005096", "evidence": [ { "database": "UniProtKB", "id": "B2RWW0", "url": "https://www.uniprot.org/uniprot/B2RWW0" } ], "pmid": "" }, { "name": "guanyl-nucleotide exchange factor activity", "id": "GO:0005085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005085", "evidence": [ { "database": "UniProtKB", "id": "B2RWW0", "url": "https://www.uniprot.org/uniprot/B2RWW0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "B2RWW0", "url": "https://www.uniprot.org/uniprot/B2RWW0" } ], "pmid": "" }, { "name": "defense response to virus", "id": "GO:0051607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051607", "evidence": [ { "database": "UniProtKB", "id": "B2RWW0", "url": "https://www.uniprot.org/uniprot/B2RWW0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 306, "end_pos": 308, "annotation": "n_glycosylation_sequon" }, { "start_pos": 378, "end_pos": 380, "annotation": "n_glycosylation_sequon" }, { "start_pos": 442, "end_pos": 444, "annotation": "n_glycosylation_sequon" }, { "start_pos": 555, "end_pos": 557, "annotation": "n_glycosylation_sequon" }, { "start_pos": 97, "end_pos": 99, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }