{ "uniprot_canonical_ac": "B1AQL3-1", "uniprot_ac": "B1AQL3", "uniprot_id": "TM235_MOUSE", "mass": { "chemical_mass": 21957.0, "monoisotopic_mass": 21957.0 }, "refseq": {}, "gene_names": [ { "name": "Tmem235", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/B1AQL3", "id": "B1AQL3" }, { "name": "Cldn27", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/B1AQL3", "id": "B1AQL3" }, { "name": "Gm12581", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/B1AQL3", "id": "B1AQL3" } ], "protein_names": [ { "name": "Transmembrane protein 235", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "B1AQL3" }, { "name": "Claudin-27", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "B1AQL3" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "B1AQL3", "url": "https://www.uniprot.org/uniprot/B1AQL3" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Tmem235", "url": "https://www.uniprot.org/uniprot/B1AQL3", "locus": { "chromosome": "11", "start_pos": 117756369, "end_pos": 117751578, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000070330", "url": "https://www.ensembl.org/id/ENSMUSG00000070330" } ] } } ], "crossref": [ { "id": "ENSMUSG00000070330", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000070330", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR004031", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004031", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039951", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039951", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:546519", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:546519", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "3651706", "url": "http://www.informatics.jax.org/marker/MGI:3651706", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "LWRTCEG", "url": "https://omabrowser.org/oma/group/LWRTCEG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4615194at2759", "url": "http://www.orthodb.org/?query=4615194at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR20516", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20516", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR20516:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20516:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13903", "url": "http://pfam.xfam.org/family/PF13903", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_B1AQL3", "url": "http://purl.obolibrary.org/obo/PR_B1AQL3", "database": "PRO", "categories": [ "Protein" ] }, { "id": "B1AQL3", "url": "https://www.uniprot.org/uniprot/B1AQL3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B1AQL3-1", "url": "https://www.uniprot.org/uniprot/B1AQL3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MALLATLLLSAALGALLSFALLAAAVASDYWYILEVADAGGLGGVQLFSHSGLWRTCEGQNSCVPLIDPFASAGLEVSPSVQHLLSLHRTVMVVLPLSLVLIVCGWVCGLLSSLSQSVPLLLATGCYFLLGGALTLAGLSIYISYSHLAFVEAARTYGVTHVQNVHISFGWSLALAWASCASEVLSGALLLAAARLLSLSQRPGVPHSVIL", "length": 211, "header": "sp|B1AQL3-1|TM235_MOUSE Isoform 1 of Transmembrane protein 235 OS=Mus musculus OX=10090 GN=Tmem235 PE=1 SV=3 CANONICAL=B1AQL3-1" }, "isoforms": [ { "isoform_ac": "B1AQL3-1", "url": "", "sequence": { "sequence": "MALLATLLLSAALGALLSFALLAAAVASDYWYILEVADAGGLGGVQLFSHSGLWRTCEGQNSCVPLIDPFASAGLEVSPSVQHLLSLHRTVMVVLPLSLVLIVCGWVCGLLSSLSQSVPLLLATGCYFLLGGALTLAGLSIYISYSHLAFVEAARTYGVTHVQNVHISFGWSLALAWASCASEVLSGALLLAAARLLSLSQRPGVPHSVIL", "length": 211, "header": "sp|B1AQL3-1|TM235_MOUSE Isoform 1 of Transmembrane protein 235 OS=Mus musculus OX=10090 GN=Tmem235 PE=1 SV=3 CANONICAL=B1AQL3-1" }, "locus": { "chromosome": "11", "start_pos": 117755182, "end_pos": 117751578, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000093905", "url": "https://www.ensembl.org/id/ENSMUST00000093905" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000091432", "url": "https://www.ensembl.org/id/ENSMUSP00000091432" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The cataract-associated protein TMEM114, and TMEM235, are glycosylated transmembrane proteins that are distinct from claudin family members.", "journal": "FEBS Lett.", "date": "2011", "authors": "Maher GJ, Hilton EN, Urquhart JE, Davidson AE, Spencer HL, Black GC, Manson FD", "evidence": [ { "database": "UniProtKB", "id": "B1AQL3", "url": "https://www.uniprot.org/uniprot/B1AQL3" } ], "reference": [ { "type": "PubMed", "id": "21689651", "url": "https://glygen.org/publication/PubMed/21689651" } ] } ], "pathway": [ { "id": "mmu:546519", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:546519", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A6NFC5-1", "protein_name": "Transmembrane protein 235", "gene_name": "TMEM235", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARLGALLLAAALGALLSFALLAAAVASDYWYILEVADAGNGSAWPGRAELLSSHSGLWRICEGQNGCIPLVDPFASESLDVSTSVQHLILLHRAVIVVLPLSLVLLVCGWICGLLSSLAQSVSLLLFTGCYFLLGSVLTLAGVSIYISYSHLAFAETVQQYGPQHMQGVRVSFGWSMALAWGSCALEAFSGTLLLSAAWTLSLSPPICGHLSPQQVGGRGGD", "length": 223 }, "evidence": [ { "id": "B1AQL3", "url": "https://omabrowser.org/oma/group/B1AQL3/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "B1AQL3", "url": "https://www.uniprot.org/uniprot/B1AQL3" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "B1AQL3", "url": "https://www.uniprot.org/uniprot/B1AQL3" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "B1AQL3", "url": "https://www.uniprot.org/uniprot/B1AQL3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "N-glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "B1AQL3", "url": "https://www.uniprot.org/uniprot/B1AQL3" }, { "database": "PubMed", "id": "21689651", "url": "https://glygen.org/publication/PubMed/21689651" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }