{ "uniprot_canonical_ac": "A8R0U8-1", "uniprot_ac": "A8R0U8", "uniprot_id": "A8R0U8_MOUSE", "mass": { "chemical_mass": 9879.0, "monoisotopic_mass": 9879.0 }, "refseq": { "ac": "NP_001231580", "name": "uncharacterized protein LOC668200 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001231580" }, "gene_names": [ { "name": "Esp15", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A8R0U8", "id": "A8R0U8" }, { "name": "EG668200; Esp16; Gm9041", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001231580", "id": "NP_001231580" }, { "name": "Esp15", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001231580", "id": "NP_001231580" }, { "name": "Gm9041", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A8R0U8", "id": "A8R0U8" } ], "protein_names": [ { "name": "Exocrine gland secreted peptide 15", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A8R0U8" }, { "name": "Exocrine gland-secreting peptide 15", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A8R0U8" }, { "name": "exocrine gland-secreting peptide 15", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001231580", "id": "NP_001231580" }, { "name": "uncharacterized protein LOC668200 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001231580", "id": "NP_001231580" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A8R0U8", "url": "https://www.uniprot.org/uniprot/A8R0U8" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Esp15", "url": "https://www.uniprot.org/uniprot/A8R0U8", "locus": { "chromosome": "17", "start_pos": 39956557, "end_pos": 39951845, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000095104", "url": "https://www.ensembl.org/id/ENSMUSG00000095104" } ] } } ], "crossref": [ { "id": "ENSMUSG00000095104", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000095104", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd14250", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14250", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "668200", "url": "https://www.ncbi.nlm.nih.gov/gene/668200", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR032253", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032253", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:668200", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:668200", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "3647149", "url": "http://www.informatics.jax.org/marker/MGI:3647149", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "4854077at2759", "url": "http://www.orthodb.org/?query=4854077at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PF16590", "url": "http://pfam.xfam.org/family/PF16590", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001231580", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001231580", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A8R0U8", "url": "https://www.uniprot.org/uniprot/A8R0U8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8R0U8-1", "url": "https://www.uniprot.org/uniprot/A8R0U8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASFPLMYFLIILVFPTILLEGMALKRTEKEPNISADLNDDFEISFIQTIRDRLDLMRMLSGSVIGKIYLNYDVVMYCRECSLTM", "length": 85, "header": "tr|A8R0U8-1|A8R0U8_MOUSE Isoform 1 of Exocrine gland secreted peptide 15 OS=Mus musculus OX=10090 GN=Esp15 PE=4 SV=1 CANONICAL=A8R0U8-1" }, "isoforms": [ { "isoform_ac": "A8R0U8-1", "url": "", "sequence": { "sequence": "MASFPLMYFLIILVFPTILLEGMALKRTEKEPNISADLNDDFEISFIQTIRDRLDLMRMLSGSVIGKIYLNYDVVMYCRECSLTM", "length": 85, "header": "tr|A8R0U8-1|A8R0U8_MOUSE Isoform 1 of Exocrine gland secreted peptide 15 OS=Mus musculus OX=10090 GN=Esp15 PE=4 SV=1 CANONICAL=A8R0U8-1" }, "locus": { "chromosome": "17", "start_pos": 39955689, "end_pos": 39953515, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000178929.3", "url": "https://www.ensembl.org/id/ENSMUST00000178929.3" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000137292.2", "url": "https://www.ensembl.org/id/ENSMUSP00000137292.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Sex- and strain-specific expression and vomeronasal activity of mouse ESP family peptides.", "journal": "Curr. Biol.", "date": "2007", "authors": "Kimoto H, Sato K, Nodari F, Haga S, Holy TE, Touhara K", "evidence": [ { "database": "UniProtKB", "id": "A8R0U8", "url": "https://www.uniprot.org/uniprot/A8R0U8" } ], "reference": [ { "type": "PubMed", "id": "17935991", "url": "https://glygen.org/publication/PubMed/17935991" } ] } ], "pathway": [ { "id": "mmu:668200", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:668200", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A8R0U8", "url": "https://www.uniprot.org/uniprot/A8R0U8" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A8R0U8", "url": "https://www.uniprot.org/uniprot/A8R0U8" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "pheromone activity", "id": "GO:0005186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005186", "evidence": [ { "database": "UniProtKB", "id": "A8R0U8", "url": "https://www.uniprot.org/uniprot/A8R0U8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 33, "end_pos": 35, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }