{ "uniprot_canonical_ac": "A6IQV7-1", "uniprot_ac": "A6IQV7", "uniprot_id": "A6IQV7_RAT", "mass": { "chemical_mass": 11368.0, "monoisotopic_mass": 11368.0 }, "refseq": { "ac": "NP_001019452", "name": "resistin-like beta precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019452" }, "gene_names": [ { "name": "Retnlb", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A6IQV7", "id": "A6IQV7" }, { "name": "Retnlb", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019452", "id": "NP_001019452" } ], "protein_names": [ { "name": "Resistin-like beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A6IQV7" }, { "name": "resistin-like beta precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019452", "id": "NP_001019452" } ], "function": [ { "annotation": "Secreted by the inner dental enamel epithelium and became localized in the matrix at the surface of the apical root dentin; might be involved in cementogenesis", "evidence": [ { "database": "RefSeq", "id": "NP_001019452", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019452" }, { "database": "PubMed", "id": "28681425", "url": "https://glygen.org/publication/PubMed/28681425" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A6IQV7", "url": "https://www.uniprot.org/uniprot/A6IQV7" } ], "common_name": "Rat" } ], "gene": [ { "name": "Retnlb", "url": "https://www.uniprot.org/uniprot/A6IQV7", "locus": { "chromosome": "11", "start_pos": 51983483, "end_pos": 51985368, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000032187", "url": "https://www.ensembl.org/id/ENSRNOG00000032187" } ] } } ], "crossref": [ { "id": "ENSRNOG00000032187", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000032187", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd16333", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16333", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "498074", "url": "https://www.ncbi.nlm.nih.gov/gene/498074", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR009714", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009714", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036262", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036262", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:498074", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:498074", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "ENTCHCQ", "url": "https://omabrowser.org/oma/group/ENTCHCQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4323821at2759", "url": "http://www.orthodb.org/?query=4323821at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR21101", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21101", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21101:SF13", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21101:SF13", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF06954", "url": "http://pfam.xfam.org/family/PF06954", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001019452", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019452", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1624215", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1624215", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A6IQV7", "url": "https://www.uniprot.org/uniprot/A6IQV7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6IQV7-1", "url": "https://www.uniprot.org/uniprot/A6IQV7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKPTLCFLFILIFLLSLMVPGNTQCSFESLVDQKIKKALSQQKTKKLSCTSITAAGRLASCPVGMVVTGCACGYACGSWDIRDGTTCHCQCAVMDWVTARCCQMV", "length": 105, "header": "tr|A6IQV7-1|A6IQV7_RAT Isoform 1 of Resistin-like beta OS=Rattus norvegicus OX=10116 GN=Retnlb PE=2 SV=1 CANONICAL=A6IQV7-1" }, "isoforms": [ { "isoform_ac": "A6IQV7-1", "url": "", "sequence": { "sequence": "MKPTLCFLFILIFLLSLMVPGNTQCSFESLVDQKIKKALSQQKTKKLSCTSITAAGRLASCPVGMVVTGCACGYACGSWDIRDGTTCHCQCAVMDWVTARCCQMV", "length": 105, "header": "tr|A6IQV7-1|A6IQV7_RAT Isoform 1 of Resistin-like beta OS=Rattus norvegicus OX=10116 GN=Retnlb PE=2 SV=1 CANONICAL=A6IQV7-1" }, "locus": { "chromosome": "11", "start_pos": 51985134, "end_pos": 51983622, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000046890.4", "url": "https://www.ensembl.org/id/ENSRNOT00000046890.4" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000040075.3", "url": "https://www.ensembl.org/id/ENSRNOP00000040075.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Localization of RELM-beta/FIZZ2 Is Associated with Cementum Formation.", "journal": "Anatomical record (Hoboken, N.J. : 2007)", "date": "2017", "authors": "Hosoya A, Takahama A, Nakamura H", "evidence": [ { "database": "RefSeq", "id": "NP_001019452", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019452" } ], "reference": [ { "type": "PubMed", "id": "28681425", "url": "https://glygen.org/publication/PubMed/28681425" } ] } ], "pathway": [ { "id": "rno:498074", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:498074", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q99P86-1", "protein_name": "Resistin-like beta", "gene_name": "Retnlb", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKPTLCFLFILVSLFPLIVPGNAQCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLASCPAGMVVTGCACGYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA", "length": 105 }, "evidence": [ { "id": "45243467", "url": "http://www.informatics.jax.org/homology/45243467", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9BQ08-1", "protein_name": "Resistin-like beta", "gene_name": "RETNLB", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGPSSCLLLILIPLLQLINPGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT", "length": 111 }, "evidence": [ { "id": "45243467", "url": "http://www.informatics.jax.org/homology/45243467", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A6IQV7", "url": "https://www.uniprot.org/uniprot/A6IQV7" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A6IQV7", "url": "https://www.uniprot.org/uniprot/A6IQV7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "response to bacterium", "id": "GO:0009617", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009617", "evidence": [ { "database": "UniProtKB", "id": "A6IQV7", "url": "https://www.uniprot.org/uniprot/A6IQV7" } ], "pmid": "" }, { "name": "epithelial cell proliferation", "id": "GO:0050673", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050673", "evidence": [ { "database": "UniProtKB", "id": "A6IQV7", "url": "https://www.uniprot.org/uniprot/A6IQV7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "hormone activity", "id": "GO:0005179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005179", "evidence": [ { "database": "UniProtKB", "id": "A6IQV7", "url": "https://www.uniprot.org/uniprot/A6IQV7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }