{ "uniprot_canonical_ac": "A2AVZ9-1", "uniprot_ac": "A2AVZ9", "uniprot_id": "S43A3_MOUSE", "mass": { "chemical_mass": 56034.0, "monoisotopic_mass": 56034.0 }, "refseq": { "ac": "NP_067373", "name": "equilibrative nucleobase transporter 1 isoform a", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_067373" }, "gene_names": [ { "name": "Slc43a3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2AVZ9", "id": "A2AVZ9" }, { "name": "Eeg1; SEEEG-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_067373", "id": "NP_067373" }, { "name": "Eeg1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2AVZ9", "id": "A2AVZ9" }, { "name": "Enbt1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2AVZ9", "id": "A2AVZ9" }, { "name": "Slc43a3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_067373", "id": "NP_067373" } ], "protein_names": [ { "name": "Equilibrative nucleobase transporter 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A2AVZ9" }, { "name": "Embryonic epithelia gene 1 protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A2AVZ9" }, { "name": "Solute carrier family 43 member 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A2AVZ9" }, { "name": "embryonic epithelial gene 1; selectively expressed in embryonic epithelia protein-1; embryonic epithelia gene 1 protein; equilibrative nucleobase transporter 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_067373", "id": "NP_067373" }, { "name": "equilibrative nucleobase transporter 1 isoform a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_067373", "id": "NP_067373" } ], "function": [ { "annotation": "SLC43A3 is an equilibrative nucleobase transporter involved in purine salvage in mammals. Erratum:[Sci Rep. 2016;6:22175. PMID: 26940463] Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_067373", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_067373" }, { "database": "PubMed", "id": "26455426", "url": "https://glygen.org/publication/PubMed/26455426" } ] }, { "annotation": "Slc43a3 is a regulator of free fatty acid flux.", "evidence": [ { "database": "RefSeq", "id": "NP_067373", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_067373" }, { "database": "PubMed", "id": "32217606", "url": "https://glygen.org/publication/PubMed/32217606" } ] }, { "annotation": "Sodium-independent purine-selective nucleobase transporter which mediates the equilibrative transport of extracellular purine nucleobases such as adenine, guanine and hypoxanthine (By similarity). May regulate fatty acid (FA) transport in adipocytes, acting as a positive regulator of FA efflux and as a negative regulator of FA uptake (PubMed:32217606).", "evidence": [ { "database": "UniProtKB", "id": "A2AVZ9", "url": "https://www.uniprot.org/uniprot/A2AVZ9#function" }, { "database": "PubMed", "id": "32217606", "url": "https://glygen.org/publication/PubMed/32217606" }, { "database": "UniProtKB", "id": "Q8NBI5", "url": "https://www.uniprot.org/uniprot/Q8NBI5#function" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs3388564014", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388564014" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 220, "end_pos": 220, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->HYS).", "chr_id": "2", "chr_pos": "84777310", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N220", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs3388568935", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388568935" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 451, "end_pos": 451, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (IVS->NVS).", "chr_id": "2", "chr_pos": "84786672", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I451", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A2AVZ9", "url": "https://www.uniprot.org/uniprot/A2AVZ9" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Slc43a3", "url": "https://www.uniprot.org/uniprot/A2AVZ9", "locus": { "chromosome": "2", "start_pos": 84788853, "end_pos": 84766923, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000027074", "url": "https://www.ensembl.org/id/ENSMUSG00000027074" } ] } } ], "crossref": [ { "id": "ENSMUSG00000027074", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000027074", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "58207", "url": "https://www.ncbi.nlm.nih.gov/gene/58207", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "GPDB0001734", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0001734", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0001735", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0001735", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0001807", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0001807", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0007945", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0007945", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "IPR011701", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011701", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027197", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027197", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036259", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036259", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:58207", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:58207", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1931054", "url": "http://www.informatics.jax.org/marker/MGI:1931054", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "QQIRTPW", "url": "https://omabrowser.org/oma/group/QQIRTPW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "297315at2759", "url": "http://www.orthodb.org/?query=297315at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR20765", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20765", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR20765:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20765:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07690", "url": "http://pfam.xfam.org/family/PF07690", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A2AVZ9", "url": "http://purl.obolibrary.org/obo/PR_A2AVZ9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_067373", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_067373", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "71515", "url": "https://www.rhea-db.org/rhea/71515", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71523", "url": "https://www.rhea-db.org/rhea/71523", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71531", "url": "https://www.rhea-db.org/rhea/71531", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A2AVZ9", "url": "https://www.uniprot.org/uniprot/A2AVZ9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2AVZ9-1", "url": "https://www.uniprot.org/uniprot/A2AVZ9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2AVZ9-2", "url": "https://www.uniprot.org/uniprot/A2AVZ9-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6PWZ8", "url": "https://www.uniprot.org/uniprot/A6PWZ8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6PWZ8-1", "url": "https://www.uniprot.org/uniprot/A6PWZ8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6PWZ9", "url": "https://www.uniprot.org/uniprot/A6PWZ9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6PWZ9-1", "url": "https://www.uniprot.org/uniprot/A6PWZ9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Z4YM12", "url": "https://www.uniprot.org/uniprot/Z4YM12", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Z4YM12-1", "url": "https://www.uniprot.org/uniprot/Z4YM12-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASKGLPLYLATLLTGLLECIGFAGVLFGWTSLLFVFKAENYFSEPCEQDCLLQSNVTGPSDLKAQDEKFSLIFTLASFMNNFMTFPTGYIFDRFKTTVARLIAIFFYTCATIIIAFTSANTAMLLFLAMPMLAVGGILFLITNLQIGNLFGKHRSTIITLYNGAFDSSSAVFLVIKLLYEQGISLRSSFIFMSVCSVWHIARTFLLMPKGHIPYPLPPNYSYGLCSRFGASKKENKAAEHETKELRSKECLPPKEENSGPEQQQQQEQQQQQQQQQEQHEQHSFRRCALSRRFILHVVWLSIIQLWHYLFIGTLNSLLTKLSGGDKVEVSAYTNAFAITQFFGVLCAPWNGLLMDRLKQKYQKAAKRTGSSSEAVALCSMVPSLALTSLLSLGFALCASIPVMQLQYATFILQVVSRSFLYGCNAAFLTLAFPSEHFGKLFGLVMALSAIVSLLQFPLFKVSPESNAVYVSMGLAIFLTLVHPFLVYRECRAEKTKSSVDA", "length": 502, "header": "sp|A2AVZ9-1|S43A3_MOUSE Isoform 1 of Equilibrative nucleobase transporter 1 OS=Mus musculus OX=10090 GN=Slc43a3 PE=1 SV=1 CANONICAL=A2AVZ9-1" }, "isoforms": [ { "isoform_ac": "A2AVZ9-1", "url": "", "sequence": { "sequence": "MASKGLPLYLATLLTGLLECIGFAGVLFGWTSLLFVFKAENYFSEPCEQDCLLQSNVTGPSDLKAQDEKFSLIFTLASFMNNFMTFPTGYIFDRFKTTVARLIAIFFYTCATIIIAFTSANTAMLLFLAMPMLAVGGILFLITNLQIGNLFGKHRSTIITLYNGAFDSSSAVFLVIKLLYEQGISLRSSFIFMSVCSVWHIARTFLLMPKGHIPYPLPPNYSYGLCSRFGASKKENKAAEHETKELRSKECLPPKEENSGPEQQQQQEQQQQQQQQQEQHEQHSFRRCALSRRFILHVVWLSIIQLWHYLFIGTLNSLLTKLSGGDKVEVSAYTNAFAITQFFGVLCAPWNGLLMDRLKQKYQKAAKRTGSSSEAVALCSMVPSLALTSLLSLGFALCASIPVMQLQYATFILQVVSRSFLYGCNAAFLTLAFPSEHFGKLFGLVMALSAIVSLLQFPLFKVSPESNAVYVSMGLAIFLTLVHPFLVYRECRAEKTKSSVDA", "length": 502, "header": "sp|A2AVZ9-1|S43A3_MOUSE Isoform 1 of Equilibrative nucleobase transporter 1 OS=Mus musculus OX=10090 GN=Slc43a3 PE=1 SV=1 CANONICAL=A2AVZ9-1" }, "locus": { "chromosome": "2", "start_pos": 84788125, "end_pos": 84768030, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000090726", "url": "https://www.ensembl.org/id/ENSMUST00000090726" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000088227", "url": "https://www.ensembl.org/id/ENSMUSP00000088227" } ] } }, { "isoform_ac": "A2AVZ9-2", "url": "", "sequence": { "sequence": "MASKGLPLYLATLLTGLLECIGFAGVLFGWTSLLFVFKAENYFSEPCEQDCLLQSNVTGPSDLKAQDEKFSLIFTLASFMNNFMTFPTGYIFDRFKTTVARLIAIFFYTCATIIIAFTSANTAMLLFLAMPMLAVGGILFLITNLQIGNLFGKHRSTIITLYNGAFDSSSAVFLVIKLLYEQGISLRSSFIFMSVCSVWHIARTFLLMPKGHIPYPLPPNYSYG", "length": 224, "header": "sp|A2AVZ9-2|S43A3_MOUSE Isoform 2 of Equilibrative nucleobase transporter 1 OS=Mus musculus OX=10090 GN=Slc43a3 PE=1 SV=1 CANONICAL=A2AVZ9-1" }, "locus": {} }, { "isoform_ac": "A6PWZ8-1", "url": "", "sequence": { "sequence": "MASKGLPLYLATLLTGLLECIGFAGVLFGWTSLLFVFKAENYFSEPCEQ", "length": 49, "header": "tr|A6PWZ8-1|S43A3_MOUSE Computationally mapped isoform of Equilibrative nucleobase transporter 1 OS=Mus musculus OX=10090 GN=Slc43a3 PE=1 SV=1 CANONICAL=A2AVZ9-1" }, "locus": { "chromosome": "2", "start_pos": 84768176, "end_pos": 84768030, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000130278.2", "url": "https://www.ensembl.org/id/ENSMUST00000130278.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000119122.2", "url": "https://www.ensembl.org/id/ENSMUSP00000119122.2" } ] } }, { "isoform_ac": "A6PWZ9-1", "url": "", "sequence": { "sequence": "MASKGLPLYLATLLTGLLECIGFAGVLFGWTSLLFVFKAENYFSEPCEQDCLLQSNVTGPSDLKAQDEKFSLIFTLASFMNNFMTFPTGYIFDRFKT", "length": 97, "header": "tr|A6PWZ9-1|S43A3_MOUSE Computationally mapped isoform of Equilibrative nucleobase transporter 1 OS=Mus musculus OX=10090 GN=Slc43a3 PE=1 SV=1 CANONICAL=A2AVZ9-1" }, "locus": { "chromosome": "2", "start_pos": 84768673, "end_pos": 84768030, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000138719.8", "url": "https://www.ensembl.org/id/ENSMUST00000138719.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000121959.2", "url": "https://www.ensembl.org/id/ENSMUSP00000121959.2" } ] } }, { "isoform_ac": "Z4YM12-1", "url": "", "sequence": { "sequence": "MASKGLPLYLATLLTGLLECIGFAGVLFGWTSLLFVFKAENYFSEPCEQDCLLQSNVTGPSDLKAQDEKFSLIFTLASFMNNFMTFPTGYIFDRFKTTVARLIAIFFYTCATIIIAFTSANTAMLLFLAMPMLAVGGILFLITNLQIGNLFGKHRSTIITLYNGAFDSS", "length": 169, "header": "tr|Z4YM12-1|S43A3_MOUSE Computationally mapped isoform of Equilibrative nucleobase transporter 1 OS=Mus musculus OX=10090 GN=Slc43a3 PE=1 SV=1 CANONICAL=A2AVZ9-1" }, "locus": { "chromosome": "2", "start_pos": 84774930, "end_pos": 84768030, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000141650.8", "url": "https://www.ensembl.org/id/ENSMUST00000141650.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000116513.2", "url": "https://www.ensembl.org/id/ENSMUSP00000116513.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 220, "start_aa": "Asn", "end_pos": 220, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn220", "evidence": [ { "id": "A2AVZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AVZ9#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "A2AVZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AVZ9#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "EEG1, a putative transporter expressed during epithelial organogenesis: comparison with embryonic transporter expression during nephrogenesis.", "journal": "Am. J. Physiol.", "date": "2001", "authors": "Stuart RO, Pavlova A, Beier D, Li Z, Krijanovski Y, Nigam SK", "evidence": [ { "database": "UniProtKB", "id": "A2AVZ9", "url": "https://www.uniprot.org/uniprot/A2AVZ9" } ], "reference": [ { "type": "PubMed", "id": "11704567", "url": "https://glygen.org/publication/PubMed/11704567" } ] }, { "title": "Functional identification of SLC43A3 as an equilibrative nucleobase transporter involved in purine salvage in mammals.", "journal": "Scientific reports", "date": "2015", "authors": "Furukawa J, Inoue K, Maeda J, Yasujima T, Ohta K, Kanai Y, Takada T, Matsuo H, Yuasa H", "evidence": [ { "database": "RefSeq", "id": "NP_067373", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_067373" } ], "reference": [ { "type": "PubMed", "id": "26455426", "url": "https://glygen.org/publication/PubMed/26455426" } ] }, { "title": "Slc43a3 is a regulator of free fatty acid flux.", "journal": "J. Lipid Res.", "date": "2020", "authors": "Hasbargen KB, Shen WJ, Zhang Y, Hou X, Wang W, Shuo Q, Bernlohr DA, Azhar S, Kraemer FB", "evidence": [ { "database": "UniProtKB", "id": "A2AVZ9", "url": "https://www.uniprot.org/uniprot/A2AVZ9" }, { "database": "RefSeq", "id": "NP_067373", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_067373" } ], "reference": [ { "type": "PubMed", "id": "32217606", "url": "https://glygen.org/publication/PubMed/32217606" } ] } ], "pathway": [ { "id": "mmu:58207", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:58207", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D4A832-1", "protein_name": "Solute carrier family 43, member 3", "gene_name": "Slc43a3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MASQLPLYLATFLTGLLECIGFAGVLFGWTSLLFVFKAENYFLKPCEQDCVLGGNTTGLPDLKAQDEKFSLIFTLASFMNNFMTFPTGYIFDRFKTAVARLLAIFFYTCATLIIAFTSADTAMLLFLAMPMLAVGGILFLITNLQIGNLFGKHRSTIITFYNGAFDSSSAVFLIIKLLYEQGISLRHSFIFLSVCSAWHVGRTFLLMPRGHIPYPLPPNYSYGLCSRFCTRKEENEAAEHETKELQSRECQSPKEENSGPEQQQQQQQQQQQQQQQQQQHSFRRCVFSHRFILHVVWLSIIQLWHYLFIGTLNSLLTKLAGEDSVKVSAYTNAFAITQFFGVLCAPWNGLLMDCLKQKYQKEAKRTGLSSEAVALCSMVPSLALTSLLSLGFTLCASIPVIELQYATFILQVVSRSFLYGCNAAFLTLAFPSEHFGKLFGLVMALSAIVSLLQFPLFKVSPESKAVYVSMGLAIFLTLVHPFLVYRECRVEKTKPSVDA", "length": 499 }, "evidence": [ { "id": "45230683", "url": "http://www.informatics.jax.org/homology/45230683", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q04991-1", "protein_name": "Protein FMP42", "gene_name": "FMP42", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MTSTRTLRYAQVACACIWCLFSAGIIFGFAALKPILISEGVYHELCDPKDGDRLLCTAQDLKLNFIFALSATVTNIMALPVGKILDMYGPRVCGIIGSCLLFLASGNFISAKHLVSLWDPYLVGYTLLAVAGPFVFISCFQLANSFPQRSGTVLALLTGSFDSSSALFLLYRLLYQNWFPTLNVSRFFTLYLIVPVFILACQLTIMPHSSYKTVNHIAKIAVEGLDENGRLIEGDTGSGIIPDEQERQSLIAIEREEDSIPSRPQRRKSVLETYVEDKLQKKSGGIFGVLHGKSAYEQIKSPWFYLMLLFALVAMLRINYFIATVRTQEEYLLNDPDLALKLNSIFDMLLPLGGAVSIPFIGLLLDHTDTLSTLTILFTTSTAIGVFGLIPNSFTWNLIGIVLLVVYRPFYYTVVSDYSSKVFGFDTFGTVYGLLSCICGIFNMSQNLLDKWTHTTFNMNPFPINLTLVILTVVFSLTLTFYIRSQILPKPVNERGLSSNYQTI", "length": 504 }, "evidence": [ { "id": "A2AVZ9", "url": "https://omabrowser.org/oma/group/A2AVZ9/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q8NBI5-1", "protein_name": "Equilibrative nucleobase transporter 1", "gene_name": "SLC43A3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPDAGPIGNATGQADCKAQDERFSLIFTLGSFMNNFMTFPTGYIFDRFKTTVARLIAIFFYTTATLIIAFTSAGSAVLLFLAMPMLTIGGILFLITNLQIGNLFGQHRSTIITLYNGAFDSSSAVFLIIKLLYEKGISLRASFIFISVCSTWHVARTFLLMPRGHIPYPLPPNYSYGLCPGNGTTKEEKETAEHENRELQSKEFLSAKEETPGAGQKQELRSFWSYAFSRRFAWHLVWLSVIQLWHYLFIGTLNSLLTNMAGGDMARVSTYTNAFAFTQFGVLCAPWNGLLMDRLKQKYQKEARKTGSSTLAVALCSTVPSLALTSLLCLGFALCASVPILPLQYLTFILQVISRSFLYGSNAAFLTLAFPSEHFGKLFGLVMALSAVVSLLQFPIFTLIKGSLQNDPFYVNVMFMLAILLTFFHPFLVYRECRTWKESPSAIA", "length": 491 }, "evidence": [ { "id": "45230683", "url": "http://www.informatics.jax.org/homology/45230683", "database": "MGI" }, { "id": "A2AVZ9", "url": "https://omabrowser.org/oma/group/A2AVZ9/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A2AVZ9", "url": "https://www.uniprot.org/uniprot/A2AVZ9" } ], "pmid": "" }, { "name": "basolateral plasma membrane", "id": "GO:0016323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016323", "evidence": [ { "database": "UniProtKB", "id": "A2AVZ9", "url": "https://www.uniprot.org/uniprot/A2AVZ9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "fatty acid transmembrane transporter activity", "id": "GO:0015245", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015245", "evidence": [ { "database": "UniProtKB", "id": "A2AVZ9", "url": "https://www.uniprot.org/uniprot/A2AVZ9" } ], "pmid": "" }, { "name": "xenobiotic transmembrane transporter activity", "id": "GO:0042910", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042910", "evidence": [ { "database": "UniProtKB", "id": "A2AVZ9", "url": "https://www.uniprot.org/uniprot/A2AVZ9" } ], "pmid": "" }, { "name": "adenine transmembrane transporter activity", "id": "GO:0015207", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015207", "evidence": [ { "database": "UniProtKB", "id": "A2AVZ9", "url": "https://www.uniprot.org/uniprot/A2AVZ9" } ], "pmid": "" }, { "name": "guanine transmembrane transporter activity", "id": "GO:0015208", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015208", "evidence": [ { "database": "UniProtKB", "id": "A2AVZ9", "url": "https://www.uniprot.org/uniprot/A2AVZ9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "hypoxanthine transport", "id": "GO:0035344", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035344", "evidence": [ { "database": "UniProtKB", "id": "A2AVZ9", "url": "https://www.uniprot.org/uniprot/A2AVZ9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 220, "end_pos": 222, "annotation": "n_glycosylation_sequon" }, { "start_pos": 56, "end_pos": 58, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "71515", "name": "", "equation": "hypoxanthine(out) = hypoxanthine(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71515", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71515" } ] }, { "id": "71523", "name": "", "equation": "adenine(out) = adenine(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71523", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71523" } ] }, { "id": "71531", "name": "", "equation": "guanine(out) = guanine(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71531", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71531" } ] } ], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }