{ "uniprot_canonical_ac": "A2AMD0-1", "uniprot_ac": "A2AMD0", "uniprot_id": "A2AMD0_MOUSE", "mass": { "chemical_mass": 28466.0, "monoisotopic_mass": 28466.0 }, "refseq": {}, "gene_names": [ { "name": "Larp7-ps", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2AMD0", "id": "A2AMD0" }, { "name": "Gm12666", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2AMD0", "id": "A2AMD0" } ], "protein_names": [ { "name": "Predicted gene 12666", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A2AMD0" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A2AMD0", "url": "https://www.uniprot.org/uniprot/A2AMD0" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Larp7-ps", "url": "https://www.uniprot.org/uniprot/A2AMD0", "locus": {} } ], "crossref": [ { "id": "ENSMUSG00000066107", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000066107", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd12290", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12290", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000504", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000504", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012677", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012677", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034887", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034887", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "3650864", "url": "http://www.informatics.jax.org/marker/MGI:3650864", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "PTHR24012", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24012", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24012:SF717", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24012:SF717", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00076", "url": "http://pfam.xfam.org/family/PF00076", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A2AMD0", "url": "https://www.uniprot.org/uniprot/A2AMD0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2AMD0-1", "url": "https://www.uniprot.org/uniprot/A2AMD0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "ELLPKNVTHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVKNKPIPSLRVAEEKKKKKKKKGRIKKEESVQAKESAVDSSSSGVCKARKRPRKASEGSEAETPEAPKQPAKKKKKQDKVEASSLPEARAGKRERCSAEDEDCLPPRPKAKKRAQKDGVGQAASEVSKESRDLEFCSTEEEKETGDRKGDSLSKVKRKHMKKHKERHKMGEEVIPLRVLS", "length": 254, "header": "tr|A2AMD0-1|A2AMD0_MOUSE Isoform 1 of Predicted gene 12666 OS=Mus musculus OX=10090 GN=Larp7-ps PE=1 SV=1 CANONICAL=A2AMD0-1" }, "isoforms": [ { "isoform_ac": "A2AMD0-1", "url": "", "sequence": { "sequence": "ELLPKNVTHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVKNKPIPSLRVAEEKKKKKKKKGRIKKEESVQAKESAVDSSSSGVCKARKRPRKASEGSEAETPEAPKQPAKKKKKQDKVEASSLPEARAGKRERCSAEDEDCLPPRPKAKKRAQKDGVGQAASEVSKESRDLEFCSTEEEKETGDRKGDSLSKVKRKHMKKHKERHKMGEEVIPLRVLS", "length": 254, "header": "tr|A2AMD0-1|A2AMD0_MOUSE Isoform 1 of Predicted gene 12666 OS=Mus musculus OX=10090 GN=Larp7-ps PE=1 SV=1 CANONICAL=A2AMD0-1" }, "locus": { "chromosome": "4", "start_pos": 92079986, "end_pos": 92078983, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000123179.2", "url": "https://www.ensembl.org/id/ENSMUST00000123179.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000122212.2", "url": "https://www.ensembl.org/id/ENSMUSP00000122212.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "negative regulation of viral transcription", "id": "GO:0032897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032897", "evidence": [ { "database": "UniProtKB", "id": "A2AMD0", "url": "https://www.uniprot.org/uniprot/A2AMD0" } ], "pmid": "" }, { "name": "positive regulation of protein localization to Cajal body", "id": "GO:1904871", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904871", "evidence": [ { "database": "UniProtKB", "id": "A2AMD0", "url": "https://www.uniprot.org/uniprot/A2AMD0" } ], "pmid": "" }, { "name": "positive regulation of snRNA transcription by RNA polymerase II", "id": "GO:1905382", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905382", "evidence": [ { "database": "UniProtKB", "id": "A2AMD0", "url": "https://www.uniprot.org/uniprot/A2AMD0" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "A2AMD0", "url": "https://www.uniprot.org/uniprot/A2AMD0" } ], "pmid": "" }, { "name": "regulation of mRNA splicing, via spliceosome", "id": "GO:0048024", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048024", "evidence": [ { "database": "UniProtKB", "id": "A2AMD0", "url": "https://www.uniprot.org/uniprot/A2AMD0" } ], "pmid": "" }, { "name": "box C/D RNA 3'-end processing", "id": "GO:0000494", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000494", "evidence": [ { "database": "UniProtKB", "id": "A2AMD0", "url": "https://www.uniprot.org/uniprot/A2AMD0" } ], "pmid": "" }, { "name": "U6 2'-O-snRNA methylation", "id": "GO:1990438", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990438", "evidence": [ { "database": "UniProtKB", "id": "A2AMD0", "url": "https://www.uniprot.org/uniprot/A2AMD0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A2AMD0", "url": "https://www.uniprot.org/uniprot/A2AMD0" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A2AMD0", "url": "https://www.uniprot.org/uniprot/A2AMD0" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A2AMD0", "url": "https://www.uniprot.org/uniprot/A2AMD0" } ], "pmid": "" }, { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "A2AMD0", "url": "https://www.uniprot.org/uniprot/A2AMD0" } ], "pmid": "" }, { "name": "7SK snRNP", "id": "GO:0120259", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120259", "evidence": [ { "database": "UniProtKB", "id": "A2AMD0", "url": "https://www.uniprot.org/uniprot/A2AMD0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "7SK snRNA binding", "id": "GO:0097322", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097322", "evidence": [ { "database": "UniProtKB", "id": "A2AMD0", "url": "https://www.uniprot.org/uniprot/A2AMD0" } ], "pmid": "" }, { "name": "U6 snRNA binding", "id": "GO:0017070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017070", "evidence": [ { "database": "UniProtKB", "id": "A2AMD0", "url": "https://www.uniprot.org/uniprot/A2AMD0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 6, "end_pos": 8, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }