{ "uniprot_canonical_ac": "A2A6M5-1", "uniprot_ac": "A2A6M5", "uniprot_id": "CACO2_MOUSE", "mass": { "chemical_mass": 40136.0, "monoisotopic_mass": 40136.0 }, "refseq": { "ac": "NP_001257947", "name": "calcium-binding and coiled-coil domain-containing protein 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257947" }, "gene_names": [ { "name": "Calcoco2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2A6M5", "id": "A2A6M5" }, { "name": "2410154J16Rik; Ndp52; Ndp52l1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257947", "id": "NP_001257947" }, { "name": "Calcoco2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257947", "id": "NP_001257947" }, { "name": "Ndp52l1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2A6M5", "id": "A2A6M5" }, { "name": "Ndp52", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2A6M5", "id": "A2A6M5" } ], "protein_names": [ { "name": "Calcium-binding and coiled-coil domain-containing protein 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A2A6M5" }, { "name": "Nuclear domain 10 protein 52", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A2A6M5" }, { "name": "Nuclear domain 10 protein NDP52", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A2A6M5" }, { "name": "calcium-binding and coiled-coil domain-containing protein 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257947", "id": "NP_001257947" }, { "name": "nuclear domain 10 protein 52 like 1; nuclear domain 10 protein NDP52", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257947", "id": "NP_001257947" } ], "function": [ { "annotation": "Expression and association of NDP52 with autophagy-regulated gene proteins including LC3, as well as phosphorylated tau and amyloid-beta in brains of an Alzheimer disease model", "evidence": [ { "database": "RefSeq", "id": "NP_001257947", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257947" }, { "database": "PubMed", "id": "25450380", "url": "https://glygen.org/publication/PubMed/25450380" } ] }, { "annotation": "ND10 and ND10 components might be important defensive factors against the CMV cross-species infection Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001257947", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257947" }, { "database": "PubMed", "id": "21552525", "url": "https://glygen.org/publication/PubMed/21552525" } ] }, { "annotation": "NDP52 Protects Against Myocardial Infarction-Provoked Cardiac Anomalies Through Promoting Autophagosome-Lysosome Fusion via Recruiting TBK1 and RAB7.", "evidence": [ { "database": "RefSeq", "id": "NP_001257947", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257947" }, { "database": "PubMed", "id": "34382418", "url": "https://glygen.org/publication/PubMed/34382418" } ] }, { "annotation": "The authors conclude that the dispersion of ND10 by major immediate-early protein 1 (IE1) appears not to be important for murine cytomegalovirus replication in a mouse-cell culture.", "evidence": [ { "database": "RefSeq", "id": "NP_001257947", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257947" }, { "database": "PubMed", "id": "21632568", "url": "https://glygen.org/publication/PubMed/21632568" } ] }, { "annotation": "Xenophagy-specific receptor required for autophagy-mediated intracellular bacteria degradation (By similarity). Acts as an effector protein of galectin-sensed membrane damage that restricts the proliferation of infecting pathogens upon entry into the cytosol by targeting LGALS8-associated bacteria for autophagy (By similarity). Initially orchestrates bacteria targeting to autophagosomes and subsequently ensures pathogen degradation by regulating pathogen-containing autophagosome maturation (By similarity). Bacteria targeting to autophagosomes relies on its interaction with MAP1LC3A, MAP1LC3B and/or GABARAPL2, whereas regulation of pathogen-containing autophagosome maturation requires the interaction with MAP3LC3C (By similarity). May play a role in ruffle formation and actin cytoskeleton organization and seems to negatively regulate constitutive secretion (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "A2A6M5", "url": "https://www.uniprot.org/uniprot/A2A6M5#function" }, { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprot/Q13137#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A2A6M5", "url": "https://www.uniprot.org/uniprot/A2A6M5" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Calcoco2", "url": "https://www.uniprot.org/uniprot/A2A6M5", "locus": { "chromosome": "11", "start_pos": 95990152, "end_pos": 96002790, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000006056", "url": "https://www.ensembl.org/id/ENSMUSG00000006056" } ] } } ], "crossref": [ { "id": "ENSMUSG00000006056", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000006056", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "76815", "url": "https://www.ncbi.nlm.nih.gov/gene/76815", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR041611", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041611", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:76815", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:76815", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1343177", "url": "http://www.informatics.jax.org/marker/MGI:1343177", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "ASWEEQK", "url": "https://omabrowser.org/oma/group/ASWEEQK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3062393at2759", "url": "http://www.orthodb.org/?query=3062393at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR31915", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31915", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR31915:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31915:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF17751", "url": "http://pfam.xfam.org/family/PF17751", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A2A6M5", "url": "http://purl.obolibrary.org/obo/PR_A2A6M5", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001257947", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257947", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A2A6M5", "url": "https://www.uniprot.org/uniprot/A2A6M5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2A6M5-1", "url": "https://www.uniprot.org/uniprot/A2A6M5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2A6M5-2", "url": "https://www.uniprot.org/uniprot/A2A6M5-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2A6M5-3", "url": "https://www.uniprot.org/uniprot/A2A6M5-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2A6M5-4", "url": "https://www.uniprot.org/uniprot/A2A6M5-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2A6M5-5", "url": "https://www.uniprot.org/uniprot/A2A6M5-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G8JL78", "url": "https://www.uniprot.org/uniprot/G8JL78", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G8JL78-1", "url": "https://www.uniprot.org/uniprot/G8JL78-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDQCPIPTLLEHGNFSQVLFNNVEKFYAPRGDIMCYYTLTEKFIPRRKDWIGIFKVGWKTTQEYYTFMWAPLPKDQNKDSATQQEIQFKAYYLPKDVERYQFCYVDEDGLVRGTSVPFQFCPDPDEDIMVVINKEKVEEMEQLSEELYQQNQELKDKYADLHEQLQRKQVALEATQRVNKTLEHKVEEKASWEKEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEKEKASWEEEKASWEKEKAPWEVEKAPWKEVKAYWWNDLHR", "length": 331, "header": "sp|A2A6M5-1|CACO2_MOUSE Isoform 1 of Calcium-binding and coiled-coil domain-containing protein 2 OS=Mus musculus OX=10090 GN=Calcoco2 PE=2 SV=1 CANONICAL=A2A6M5-1" }, "isoforms": [ { "isoform_ac": "A2A6M5-1", "url": "", "sequence": { "sequence": "MDQCPIPTLLEHGNFSQVLFNNVEKFYAPRGDIMCYYTLTEKFIPRRKDWIGIFKVGWKTTQEYYTFMWAPLPKDQNKDSATQQEIQFKAYYLPKDVERYQFCYVDEDGLVRGTSVPFQFCPDPDEDIMVVINKEKVEEMEQLSEELYQQNQELKDKYADLHEQLQRKQVALEATQRVNKTLEHKVEEKASWEKEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEKEKASWEEEKASWEKEKAPWEVEKAPWKEVKAYWWNDLHR", "length": 331, "header": "sp|A2A6M5-1|CACO2_MOUSE Isoform 1 of Calcium-binding and coiled-coil domain-containing protein 2 OS=Mus musculus OX=10090 GN=Calcoco2 PE=2 SV=1 CANONICAL=A2A6M5-1" }, "locus": { "chromosome": "11", "start_pos": 95998421, "end_pos": 95990743, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000068686", "url": "https://www.ensembl.org/id/ENSMUST00000068686" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000087407", "url": "https://www.ensembl.org/id/ENSMUSP00000087407" } ] } }, { "isoform_ac": "A2A6M5-2", "url": "", "sequence": { "sequence": "MDQCPIPTLLEHGNFSQVLFNNVEKFYAPRGDIMCYYTLTEKFIPRRKDWIGIFKVGWKTTQEYYTFMWAPLPKDQNKDSATQQEIQFKAYYLPKDVERYQFCYVDEDGLVRGTSVPFQFCPDPDEDIMVVINKEKVEEMEQLSEELYQQNQELKDKYADLHEQLQRKQVALEATQRVNKTLEHKVEEKASWEKEKASWEEEKASWEEEKASWEEEKASWEKEKASWEEEKASWEKEKAPWEVEKAPWKEVKAYWWNDLHR", "length": 261, "header": "sp|A2A6M5-2|CACO2_MOUSE Isoform 2 of Calcium-binding and coiled-coil domain-containing protein 2 OS=Mus musculus OX=10090 GN=Calcoco2 PE=2 SV=1 CANONICAL=A2A6M5-1" }, "locus": {} }, { "isoform_ac": "A2A6M5-3", "url": "", "sequence": { "sequence": "MDQCPIPTLLEHGNFSQVLFNNVEKFYAPRGDIMCYYTLTEKFIPRRKDWIGIFKVGWKTTQEYYTFMWAPLPKDQNKDSATQQEIQFKAYYLPKDVERYQFCYVDEDGLVRGTSVPFQFCPDPDEDIMVVINKEKVEEMEQLSEELYQQNQELKDKYADLHEQLQRKQVALEATQRVNKTLEHKVEEKASWEKEKASWEEEKASWEEEKASWEEEKASWEEVKAYWWNDLHR", "length": 233, "header": "sp|A2A6M5-3|CACO2_MOUSE Isoform 3 of Calcium-binding and coiled-coil domain-containing protein 2 OS=Mus musculus OX=10090 GN=Calcoco2 PE=2 SV=1 CANONICAL=A2A6M5-1" }, "locus": {} }, { "isoform_ac": "A2A6M5-4", "url": "", "sequence": { "sequence": "MDQCPIPTLLEHGNFSQVLFNNVEKFYAPRGDIMCYYTLTEKFIPRRKDWIGIFKVGWKTTQEYYTFMWAPLPKDQNKDSATQQEIQFKAYYLPKDVERYQFCYVDEDGLVRGTSVPFQFCPDPDEDIMVVINKEKVEEMEQLSEELYQQNQELKDKYADLHEQLQRKQVALEATQRVNKTLEHKVEEKASWEKEKASWEKEKASWEEEKASWEKEKAPWEVEKAPWKEVKAYWWNDLHR", "length": 240, "header": "sp|A2A6M5-4|CACO2_MOUSE Isoform 4 of Calcium-binding and coiled-coil domain-containing protein 2 OS=Mus musculus OX=10090 GN=Calcoco2 PE=2 SV=1 CANONICAL=A2A6M5-1" }, "locus": {} }, { "isoform_ac": "A2A6M5-5", "url": "", "sequence": { "sequence": "MDQCPIPTLLEHGNFSQVLFNNVEKFYAPRGDIMCYYTLTEKFIPRRKDWIGIFKVGWKTTQEYYTFMWAPLPKDQNKDSATQQEIQFKAYYLPKDVERYQFCYVDEDGLVRGTSVPFQFCPDPDEDIMVVINKEKVEEMEQLSEELYQQNQELKDKYADLHEQLQRKQVALEATQRVNKTLEHKVEEKASWEKEKASWEEEKASWEKEKAPWEVEKAPWKEVKAYWWNDLHR", "length": 233, "header": "sp|A2A6M5-5|CACO2_MOUSE Isoform 5 of Calcium-binding and coiled-coil domain-containing protein 2 OS=Mus musculus OX=10090 GN=Calcoco2 PE=2 SV=1 CANONICAL=A2A6M5-1" }, "locus": {} }, { "isoform_ac": "G8JL78-1", "url": "", "sequence": { "sequence": "MDQCPIPTLLEHGNFSQVLFNNVEKFYAPRGDIMCYYTLTEKFIPRRKDWIGIFKVGWKTTQEYYTFMWAPLPKDQNKDSATQQEIQFKAYYLPKDVERYQFCYVDEDGLVRGTSVPFQFCPDPDEDIMVVINKEKVEEMEQLSEELYQQNQELKDKYADLHEQLQRKQVALEATQRVNKTLEHKVEEKASWEKEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEKEKASWEEEKASWEKEKAPWEVEKAPWKEVKAYWWNDLHR", "length": 310, "header": "tr|G8JL78-1|CACO2_MOUSE Computationally mapped isoform of Calcium-binding and coiled-coil domain-containing protein 2 OS=Mus musculus OX=10090 GN=Calcoco2 PE=2 SV=1 CANONICAL=A2A6M5-1" }, "locus": { "chromosome": "11", "start_pos": 95998421, "end_pos": 95990743, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000097162.6", "url": "https://www.ensembl.org/id/ENSMUST00000097162.6" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000103309.4", "url": "https://www.ensembl.org/id/ENSMUSP00000103309.4" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Incomplete reactivation of Oct4-related genes in mouse embryos cloned from somatic nuclei.", "journal": "Development", "date": "2003", "authors": "Page D.C., Skaletsky H., Jaenisch R., Akutsu H., Berry D.L., Bortvin A., Eggan K., Yanagimachi R.", "evidence": [ { "database": "UniProtKB", "id": "A2A6M5", "url": "https://www.uniprot.org/uniprot/A2A6M5" } ], "reference": [ { "type": "PubMed", "id": "12620990", "url": "https://glygen.org/publication/PubMed/12620990" } ] }, { "title": "Functional interaction of nuclear domain 10 and its components with cytomegalovirus after infections: cross-species host cells versus native cells.", "journal": "PloS one", "date": "2011", "authors": "Cosme RC, Martinez FP, Tang Q", "evidence": [ { "database": "RefSeq", "id": "NP_001257947", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257947" } ], "reference": [ { "type": "PubMed", "id": "21552525", "url": "https://glygen.org/publication/PubMed/21552525" } ] }, { "title": "H2B homology region of major immediate-early protein 1 is essential for murine cytomegalovirus to disrupt nuclear domain 10, but is not important for viral replication in cell culture.", "journal": "The Journal of general virology", "date": "2011", "authors": "Cosme-Cruz R, Martinez FP, Perez KJ, Tang Q", "evidence": [ { "database": "RefSeq", "id": "NP_001257947", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257947" } ], "reference": [ { "type": "PubMed", "id": "21632568", "url": "https://glygen.org/publication/PubMed/21632568" } ] }, { "title": "NDP52 associates with phosphorylated tau in brains of an Alzheimer disease mouse model.", "journal": "Biochemical and biophysical research communications", "date": "2014", "authors": "Kim S, Lee D, Song JC, Cho SJ, Yun SM, Koh YH, Song J, Johnson GV, Jo C", "evidence": [ { "database": "RefSeq", "id": "NP_001257947", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257947" } ], "reference": [ { "type": "PubMed", "id": "25450380", "url": "https://glygen.org/publication/PubMed/25450380" } ] }, { "title": "NDP52 Protects Against Myocardial Infarction-Provoked Cardiac Anomalies Through Promoting Autophagosome-Lysosome Fusion via Recruiting TBK1 and RAB7.", "journal": "Antioxidants & redox signaling", "date": "2022", "authors": "Sun M, Zhang W, Bi Y, Xu H, Abudureyimu M, Peng H, Zhang Y, Ren J", "evidence": [ { "database": "RefSeq", "id": "NP_001257947", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257947" } ], "reference": [ { "type": "PubMed", "id": "34382418", "url": "https://glygen.org/publication/PubMed/34382418" } ] } ], "pathway": [ { "id": "mmu:76815", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:76815", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q13137-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "CALCOCO2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMGLDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL", "length": 446 }, "evidence": [ { "id": "45233766", "url": "http://www.informatics.jax.org/homology/45233766", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "autophagosome membrane", "id": "GO:0000421", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000421", "evidence": [ { "database": "UniProtKB", "id": "A2A6M5", "url": "https://www.uniprot.org/uniprot/A2A6M5" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A2A6M5", "url": "https://www.uniprot.org/uniprot/A2A6M5" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A2A6M5", "url": "https://www.uniprot.org/uniprot/A2A6M5" } ], "pmid": "" }, { "name": "cytoskeleton", "id": "GO:0005856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005856", "evidence": [ { "database": "UniProtKB", "id": "A2A6M5", "url": "https://www.uniprot.org/uniprot/A2A6M5" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "A2A6M5", "url": "https://www.uniprot.org/uniprot/A2A6M5" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "A2A6M5", "url": "https://www.uniprot.org/uniprot/A2A6M5" } ], "pmid": "" }, { "name": "cytoplasmic vesicle", "id": "GO:0031410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410", "evidence": [ { "database": "UniProtKB", "id": "A2A6M5", "url": "https://www.uniprot.org/uniprot/A2A6M5" } ], "pmid": "" }, { "name": "autophagosome", "id": "GO:0005776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005776", "evidence": [ { "database": "UniProtKB", "id": "A2A6M5", "url": "https://www.uniprot.org/uniprot/A2A6M5" } ], "pmid": "" }, { "name": "PML body", "id": "GO:0016605", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016605", "evidence": [ { "database": "UniProtKB", "id": "A2A6M5", "url": "https://www.uniprot.org/uniprot/A2A6M5" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "A2A6M5", "url": "https://www.uniprot.org/uniprot/A2A6M5" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "positive regulation of autophagosome maturation", "id": "GO:1901098", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901098", "evidence": [ { "database": "UniProtKB", "id": "A2A6M5", "url": "https://www.uniprot.org/uniprot/A2A6M5" } ], "pmid": "" }, { "name": "xenophagy", "id": "GO:0098792", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098792", "evidence": [ { "database": "UniProtKB", "id": "A2A6M5", "url": "https://www.uniprot.org/uniprot/A2A6M5" } ], "pmid": "" }, { "name": "response to type II interferon", "id": "GO:0034341", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034341", "evidence": [ { "database": "UniProtKB", "id": "A2A6M5", "url": "https://www.uniprot.org/uniprot/A2A6M5" } ], "pmid": "" }, { "name": "selective autophagy", "id": "GO:0061912", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061912", "evidence": [ { "database": "UniProtKB", "id": "A2A6M5", "url": "https://www.uniprot.org/uniprot/A2A6M5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 14, "end_pos": 16, "annotation": "n_glycosylation_sequon" }, { "start_pos": 179, "end_pos": 181, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }