{ "uniprot_canonical_ac": "A1ZBX6-1", "uniprot_ac": "A1ZBX6", "uniprot_id": "A1ZBX6_DROME", "mass": { "chemical_mass": 20952.0, "monoisotopic_mass": 20952.0 }, "refseq": { "ac": "NP_001286641", "name": "uncharacterized protein, isoform B", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001286641" }, "gene_names": [ { "name": "Dmel\\CG16799", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A1ZBX6", "id": "A1ZBX6" }, { "name": "CG16799", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001286641", "id": "NP_001286641" }, { "name": "CG16799", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A1ZBX6", "id": "A1ZBX6" }, { "name": "Cg16799; Dmel\\CG16799", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001286641", "id": "NP_001286641" }, { "name": "Dmel_CG16799", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A1ZBX6", "id": "A1ZBX6" } ], "protein_names": [ { "name": "3.2.1.17", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A1ZBX6" }, { "name": "CG16799-PB", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001286641", "id": "NP_001286641" }, { "name": "Uncharacterized protein, isoform A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A1ZBX6" }, { "name": "Uncharacterized protein, isoform B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A1ZBX6" }, { "name": "uncharacterized protein, isoform B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001286641", "id": "NP_001286641" } ], "function": [], "disease": [ { "disease_id": "DOID:0050636", "recommended_name": { "id": "DOID:0050636", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050636", "name": "familial visceral amyloidosis", "description": "An amyloidosis that is characterized by the abnormal deposition of amyloid proteins that is located_in the visceral organs, primarily the kidneys." }, "synonyms": [ { "id": "DOID:0050636", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050636", "name": "AMYLOIDOSIS, FAMILIAL RENAL", "description": "" }, { "id": "DOID:0050636", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050636", "name": "German type amyloidosis", "description": "" }, { "id": "DOID:0050636", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050636", "name": "OSTERTAG TYPE AMYLOIDOSIS", "description": "" }, { "id": "DOID:0050636", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050636", "name": "systemic nonneuropathic amyloidosis", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "familial visceral amyloidosis", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "German type amyloidosis", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "Ostertag type amyloidosis", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis, 3 or more types", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis, Ostertag type", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis, familial renal", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis, renal", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "familial amyloid nephropathy", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "familial renal amyloidosis", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "hereditary amyloid nephropathy", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "hereditary renal amyloidosis", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "systemic nonneuropathic amyloidosis", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis 8", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis VIII", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis familial renal", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis familial visceral", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis systemic nonneuropathic", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis, familial visceral", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis, systemic Nonneuropathic", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "hereditary amyloidosis with primary renal involement", "description": "" }, { "id": "MIM:105200", "resource": "MIM", "url": "https://www.omim.org/entry/105200", "name": "Amyloidosis 8", "description": "Amyloidosis 8" } ], "evidence": [ { "id": "0050636", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050636" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "A1ZBX6", "url": "https://www.uniprot.org/uniprot/A1ZBX6" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "Dmel\\CG16799", "url": "https://www.uniprot.org/uniprot/A1ZBX6", "locus": { "chromosome": "2R", "start_pos": 20652557, "end_pos": 20655096, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0034538", "url": "https://www.ensembl.org/id/FBgn0034538" } ] } } ], "crossref": [ { "id": "FBgn0034538", "url": "https://bgee.org/?page=gene&gene_id=FBgn0034538", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "GH22", "url": "http://www.cazy.org/GH22.html", "database": "CAZy", "categories": [ "Protein Classification" ] }, { "id": "cd16899", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16899", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0034538", "url": "https://flybase.org/reports/FBgn0034538", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "37340", "url": "https://www.ncbi.nlm.nih.gov/gene/37340", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001916", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001916", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019799", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019799", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023346", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023346", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG16799", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG16799", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "TWCRRAK", "url": "https://omabrowser.org/oma/group/TWCRRAK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5361006at2759", "url": "http://www.orthodb.org/?query=5361006at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11407", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11407", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11407:SF63", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11407:SF63", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00062", "url": "http://pfam.xfam.org/family/PF00062", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-DME-5653890", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5653890", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-6803157", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001286641", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001286641", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A1ZBX6", "url": "https://www.uniprot.org/uniprot/A1ZBX6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A1ZBX6-1", "url": "https://www.uniprot.org/uniprot/A1ZBX6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MCLKARHPKTKRDLMNMKTFCLWIVPVLILLQLGIEQVESKKYQRCELTRVLVENYNFDKTFISNWICLVEHESYLDTTKVTKKGNESKNYGLFQINSKDYCSEGRKGGQCNMKCEDFSNDDISDDIACARMIQEREGFKYWKGWDRFCRNPQNLPNLRVACNLRSLSPVRSPRGFLTG", "length": 179, "header": "tr|A1ZBX6-1|A1ZBX6_DROME Isoform 1 of Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\\CG16799 PE=3 SV=1 CANONICAL=A1ZBX6-1" }, "isoforms": [ { "isoform_ac": "A1ZBX6-1", "url": "", "sequence": { "sequence": "MCLKARHPKTKRDLMNMKTFCLWIVPVLILLQLGIEQVESKKYQRCELTRVLVENYNFDKTFISNWICLVEHESYLDTTKVTKKGNESKNYGLFQINSKDYCSEGRKGGQCNMKCEDFSNDDISDDIACARMIQEREGFKYWKGWDRFCRNPQNLPNLRVACNLRSLSPVRSPRGFLTG", "length": 179, "header": "tr|A1ZBX6-1|A1ZBX6_DROME Isoform 1 of Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\\CG16799 PE=3 SV=1 CANONICAL=A1ZBX6-1" }, "locus": { "chromosome": "2R", "start_pos": 20655006, "end_pos": 20653218, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0086249", "url": "https://www.ensembl.org/id/FBtr0086249" }, { "database": "Ensembl Peptide", "id": "FBpp0085561", "url": "https://www.ensembl.org/id/FBpp0085561" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "A1ZBX6", "url": "https://www.uniprot.org/uniprot/A1ZBX6" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.", "journal": "Genome Biol.", "date": "2002", "authors": "Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP, Frise E, Hodgson A, George RA, Hoskins RA, Laverty T, Muzny DM, Nelson CR, Pacleb JM, Park S, Pfeiffer BD, Richards S, Sodergren EJ, Svirskas R, Tabor PE, Wan K, Stapleton M, Sutton GG, Venter C, Weinstock G, Scherer SE, Myers EW, Gibbs RA, Rubin GM", "evidence": [ { "database": "UniProtKB", "id": "A1ZBX6", "url": "https://www.uniprot.org/uniprot/A1ZBX6" } ], "reference": [ { "type": "PubMed", "id": "12537568", "url": "https://glygen.org/publication/PubMed/12537568" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "A1ZBX6", "url": "https://www.uniprot.org/uniprot/A1ZBX6" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.", "journal": "Genome Biol.", "date": "2002", "authors": "Kaminker JS, Bergman CM, Kronmiller B, Carlson J, Svirskas R, Patel S, Frise E, Wheeler DA, Lewis SE, Rubin GM, Ashburner M, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "A1ZBX6", "url": "https://www.uniprot.org/uniprot/A1ZBX6" } ], "reference": [ { "type": "PubMed", "id": "12537573", "url": "https://glygen.org/publication/PubMed/12537573" } ] }, { "title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.", "journal": "Genome Biol.", "date": "2002", "authors": "Hoskins RA, Smith CD, Carlson JW, Carvalho AB, Halpern A, Kaminker JS, Kennedy C, Mungall CJ, Sullivan BA, Sutton GG, Yasuhara JC, Wakimoto BT, Myers EW, Celniker SE, Rubin GM, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "A1ZBX6", "url": "https://www.uniprot.org/uniprot/A1ZBX6" } ], "reference": [ { "type": "PubMed", "id": "12537574", "url": "https://glygen.org/publication/PubMed/12537574" } ] }, { "title": "Combined evidence annotation of transposable elements in genome sequences.", "journal": "PLoS Comput. Biol.", "date": "2005", "authors": "Quesneville H, Bergman CM, Andrieu O, Autard D, Nouaud D, Ashburner M, Anxolabehere D", "evidence": [ { "database": "UniProtKB", "id": "A1ZBX6", "url": "https://www.uniprot.org/uniprot/A1ZBX6" } ], "reference": [ { "type": "PubMed", "id": "16110336", "url": "https://glygen.org/publication/PubMed/16110336" } ] }, { "title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Smith CD, Shu S, Mungall CJ, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "A1ZBX6", "url": "https://www.uniprot.org/uniprot/A1ZBX6" } ], "reference": [ { "type": "PubMed", "id": "17569856", "url": "https://glygen.org/publication/PubMed/17569856" } ] }, { "title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Hoskins RA, Carlson JW, Kennedy C, Acevedo D, Evans-Holm M, Frise E, Wan KH, Park S, Mendez-Lago M, Rossi F, Villasante A, Dimitri P, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "A1ZBX6", "url": "https://www.uniprot.org/uniprot/A1ZBX6" } ], "reference": [ { "type": "PubMed", "id": "17569867", "url": "https://glygen.org/publication/PubMed/17569867" } ] }, { "title": "The Release 6 reference sequence of the Drosophila melanogaster genome.", "journal": "Genome Res.", "date": "2015", "authors": "Hoskins RA, Carlson JW, Wan KH, Park S, Mendez I, Galle SE, Booth BW, Pfeiffer BD, George RA, Svirskas R, Krzywinski M, Schein J, Accardo MC, Damia E, Messina G, Mendez-Lago M, de Pablos B, Demakova OV, Andreyeva EN, Boldyreva LV, Marra M, Carvalho AB, Dimitri P, Villasante A, Zhimulev IF, Rubin GM, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "A1ZBX6", "url": "https://www.uniprot.org/uniprot/A1ZBX6" } ], "reference": [ { "type": "PubMed", "id": "25589440", "url": "https://glygen.org/publication/PubMed/25589440" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: The Rule-Benders.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Crosby MA, Gramates LS, Dos Santos G, Matthews BB, St Pierre SE, Zhou P, Schroeder AJ, Falls K, Emmert DB, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "A1ZBX6", "url": "https://www.uniprot.org/uniprot/A1ZBX6" } ], "reference": [ { "type": "PubMed", "id": "26109356", "url": "https://glygen.org/publication/PubMed/26109356" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Matthews BB, Dos Santos G, Crosby MA, Emmert DB, St Pierre SE, Gramates LS, Zhou P, Schroeder AJ, Falls K, Strelets V, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "A1ZBX6", "url": "https://www.uniprot.org/uniprot/A1ZBX6" } ], "reference": [ { "type": "PubMed", "id": "26109357", "url": "https://glygen.org/publication/PubMed/26109357" } ] } ], "pathway": [ { "id": "dme:Dmel_CG16799", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG16799", "resource": "KEGG Pathway" }, { "id": "R-DME-5653890", "name": "Lactose synthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5653890", "resource": "Reactome", "description": "Lactose synthesis" }, { "id": "R-DME-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-DME-6803157", "name": "Antimicrobial peptides", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-6803157", "resource": "Reactome", "description": "Antimicrobial peptides" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A1ZBX6", "url": "https://www.uniprot.org/uniprot/A1ZBX6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "defense response to Gram-negative bacterium", "id": "GO:0050829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050829", "evidence": [ { "database": "UniProtKB", "id": "A1ZBX6", "url": "https://www.uniprot.org/uniprot/A1ZBX6" } ], "pmid": "" }, { "name": "metabolic process", "id": "GO:0008152", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008152", "evidence": [ { "database": "UniProtKB", "id": "A1ZBX6", "url": "https://www.uniprot.org/uniprot/A1ZBX6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "lysozyme activity", "id": "GO:0003796", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003796", "evidence": [ { "database": "UniProtKB", "id": "A1ZBX6", "url": "https://www.uniprot.org/uniprot/A1ZBX6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 86, "end_pos": 88, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-DME-5653878", "name": "B4GALT1:LALBA transfers Gal from UDP-Gal to Glc to form Lac", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [ "R-ALL-964746" ], "output_participant_list": [ "R-ALL-5653871" ], "enzyme_list": [ "A1ZBX6-1", "P29615-1", "Q7KN92-1", "P37159-1", "P37160-1", "P37161-1", "P83972-1", "Q08694-1", "Q9VAQ8-1" ], "evidence": [ { "id": "R-DME-5653878", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5653878" } ] }, { "id": "R-DME-5653886", "name": "B4GALT1 binds LALBA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A1ZBX6-1", "P29615-1", "Q7KN92-1", "P37159-1", "P37160-1", "P37161-1", "P83972-1", "Q08694-1", "Q9VAQ8-1" ], "evidence": [ { "id": "R-DME-5653886", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5653886" } ] }, { "id": "R-DME-6798745", "name": "Exocytosis of tertiary granule lumen proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, tertiary granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A1ZBX6-1", "Q9VQ13-1", "Q9W5G3-1", "P29349-1", "M9NDS9-1", "Q9VBF5-1", "Q9VLK3-1", "Q9VLR2-1", "Q9VQ11-1", "Q9W122-1", "P07764-1", "Q8MPP3-1", "Q95029-1", "B7Z0E0-1", "Q9VNK6-1", "Q7K485-1", "Q86PD7-1", "Q7JQR3-1", "Q8IQM9-1", "Q9VJ39-1", "Q9VUY9-1", "Q9VGN8-1", "Q9VYH1-1", "Q9VZV2-1" ], "evidence": [ { "id": "R-DME-6798745", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-6798745" } ] }, { "id": "R-DME-6798749", "name": "Exocytosis of specific granule lumen proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, specific granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A1ZBX6-1", "Q7KUC2-1", "Q9VQ13-1", "Q9W5G3-1", "P29349-1", "M9NDS9-1", "Q9V9J3-1", "O76895-1", "Q95TL8-1", "Q9VLK3-1", "Q9VQ11-1", "Q9W122-1", "Q8MPP3-1", "Q7K485-1", "Q86PD7-1", "Q7JQR3-1", "Q8IQM9-1", "Q9VGN8-1", "Q9VZV2-1" ], "evidence": [ { "id": "R-DME-6798749", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-6798749" } ] }, { "id": "R-DME-6798751", "name": "Exocytosis of azurophil granule lumen proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, azurophil granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P40417-3", "A1Z8C9-1", "A1ZBX6-1", "Q9VZZ4-1", "Q9VQI7-1", "Q7KN62-1", "Q9V9J3-1", "Q9VSC3-1", "A1ZBG9-1", "O76895-1", "Q9V420-1", "Q7KRU8-1", "P83099-1", "Q8MR45-1", "Q8WSF3-1", "Q9VTJ4-1", "Q9VA83-1", "Q0E8H9-1", "Q8IPB7-1", "X2JGK6-1", "Q9W3C4-1", "Q8IQM9-1", "Q07152-1", "Q9VQX4-1", "Q7KN85-1", "Q9VGE7-1", "Q9VVK5-1", "Q9VYH1-1" ], "evidence": [ { "id": "R-DME-6798751", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-6798751" } ] }, { "id": "R-DME-8862300", "name": "LYZ binds bacterial peptidoglycan", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, peptidoglycan-based cell wall", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A1ZBX6-1" ], "evidence": [ { "id": "R-DME-8862300", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-8862300" } ] }, { "id": "R-DME-8862320", "name": "LYZ hydrolyzes peptidoglycans in the bacterial cell wall", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, peptidoglycan-based cell wall", "input_participant_list": [], "output_participant_list": [ "R-ALL-6788982" ], "enzyme_list": [ "A1ZBX6-1" ], "evidence": [ { "id": "R-DME-8862320", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-8862320" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-5653871", "participant_name": "Lac [Golgi lumen]", "crossref": [ { "id": "17716", "database": "ChEBI", "url": "" }, { "id": "G74621DY", "database": "GlyTouCan", "url": "" }, { "id": "000004095793", "database": "ZINC", "url": "" }, { "id": "HMDB0035312", "database": "HMDB Metabolite", "url": "" }, { "id": "000004095761", "database": "ZINC", "url": "" }, { "id": "C06373", "database": "COMPOUND", "url": "" }, { "id": "17716", "database": "ChEBI", "url": "" }, { "id": "G74621DY", "database": "GlyTouCan", "url": "" }, { "id": "000004095793", "database": "ZINC", "url": "" }, { "id": "HMDB0035312", "database": "HMDB Metabolite", "url": "" }, { "id": "000004095761", "database": "ZINC", "url": "" }, { "id": "C06373", "database": "COMPOUND", "url": "" }, { "id": "HMDB0035312", "database": "HMDB Metabolite", "url": "" }, { "id": "C06373", "database": "COMPOUND", "url": "" }, { "id": "17716", "database": "ChEBI", "url": "" }, { "id": "G74621DY", "database": "GlyTouCan", "url": "" }, { "id": "000004095761", "database": "ZINC", "url": "" }, { "id": "000004095793", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-6788982", "participant_name": "betaGlcNAc [peptidoglycan-based cell wall]", "crossref": [ { "id": "28009", "database": "ChEBI", "url": "" }, { "id": "G49108TO", "database": "GlyTouCan", "url": "" }, { "id": "C03136", "database": "COMPOUND", "url": "" }, { "id": "000003983907", "database": "ZINC", "url": "" }, { "id": "C03878", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000803", "database": "HMDB Metabolite", "url": "" }, { "id": "28009", "database": "ChEBI", "url": "" }, { "id": "G49108TO", "database": "GlyTouCan", "url": "" }, { "id": "C03136", "database": "COMPOUND", "url": "" }, { "id": "000003983907", "database": "ZINC", "url": "" }, { "id": "C03878", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000803", "database": "HMDB Metabolite", "url": "" }, { "id": "28009", "database": "ChEBI", "url": "" }, { "id": "G49108TO", "database": "GlyTouCan", "url": "" }, { "id": "C03136", "database": "COMPOUND", "url": "" }, { "id": "000003983907", "database": "ZINC", "url": "" }, { "id": "C03878", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000803", "database": "HMDB Metabolite", "url": "" }, { "id": "C03878", "database": "COMPOUND", "url": "" }, { "id": "C03136", "database": "COMPOUND", "url": "" }, { "id": "28009", "database": "ChEBI", "url": "" }, { "id": "G49108TO", "database": "GlyTouCan", "url": "" }, { "id": "HMDB0000803", "database": "HMDB Metabolite", "url": "" }, { "id": "000003983907", "database": "ZINC", "url": "" }, { "id": "28009", "database": "ChEBI", "url": "" }, { "id": "G49108TO", "database": "GlyTouCan", "url": "" }, { "id": "C03136", "database": "COMPOUND", "url": "" }, { "id": "000003983907", "database": "ZINC", "url": "" }, { "id": "C03878", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000803", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-964746", "participant_name": "Glc [Golgi lumen]", "crossref": [ { "id": "8143952", "database": "PubChem Substance", "url": "" }, { "id": "17925", "database": "ChEBI", "url": "" }, { "id": "G58161NS", "database": "GlyTouCan", "url": "" }, { "id": "HMDB0003345", "database": "HMDB Metabolite", "url": "" }, { "id": "000003861213", "database": "ZINC", "url": "" }, { "id": "C00267", "database": "COMPOUND", "url": "" }, { "id": "C00267", "database": "COMPOUND", "url": "" }, { "id": "17925", "database": "ChEBI", "url": "" }, { "id": "G58161NS", "database": "GlyTouCan", "url": "" }, { "id": "000003861213", "database": "ZINC", "url": "" }, { "id": "8143952", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0003345", "database": "HMDB Metabolite", "url": "" }, { "id": "C00267", "database": "COMPOUND", "url": "" }, { "id": "17925", "database": "ChEBI", "url": "" }, { "id": "G58161NS", "database": "GlyTouCan", "url": "" }, { "id": "000003861213", "database": "ZINC", "url": "" }, { "id": "8143952", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0003345", "database": "HMDB Metabolite", "url": "" }, { "id": "C00267", "database": "COMPOUND", "url": "" }, { "id": "17925", "database": "ChEBI", "url": "" }, { "id": "G58161NS", "database": "GlyTouCan", "url": "" }, { "id": "000003861213", "database": "ZINC", "url": "" }, { "id": "8143952", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0003345", "database": "HMDB Metabolite", "url": "" }, { "id": "C00267", "database": "COMPOUND", "url": "" }, { "id": "17925", "database": "ChEBI", "url": "" }, { "id": "G58161NS", "database": "GlyTouCan", "url": "" }, { "id": "000003861213", "database": "ZINC", "url": "" }, { "id": "8143952", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0003345", "database": "HMDB Metabolite", "url": "" }, { "id": "C00267", "database": "COMPOUND", "url": "" }, { "id": "17925", "database": "ChEBI", "url": "" }, { "id": "G58161NS", "database": "GlyTouCan", "url": "" }, { "id": "000003861213", "database": "ZINC", "url": "" }, { "id": "8143952", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0003345", "database": "HMDB Metabolite", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A1Z8C9", "gene_name": "anon-AE003828.1", "activity": [ { "ec_number": "3.5.2.17", "activity": "5-hydroxyisourate + H2O = 5-hydroxy-2-oxo-4-ureido-2,5-dihydro-1H-imidazole-5-carboxylate + H(+).", "evidence": [ { "id": "A1Z8C9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1Z8C9" } ] }, { "ec_number": "3.5.2.17", "activity": "", "evidence": [ { "id": "A1Z8C9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1Z8C9" } ] } ] }, { "uniprot_ac": "A1ZBG9", "gene_name": "Dmel\\CG15117", "activity": [ { "ec_number": "3.2.1.31", "activity": "a beta-D-glucuronoside + H2O = an alcohol + D-glucuronate.", "evidence": [ { "id": "A1ZBG9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBG9" } ] }, { "ec_number": "3.2.1.31", "activity": "", "evidence": [ { "id": "A1ZBG9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBG9" } ] } ] }, { "uniprot_ac": "A1ZBX6", "gene_name": "Dmel\\CG16799", "activity": [ { "ec_number": "3.2.1.17", "activity": "Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.", "evidence": [ { "id": "A1ZBX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBX6" } ] } ] }, { "uniprot_ac": "B7Z0E0", "gene_name": "Idh", "activity": [ { "ec_number": "1.1.1.42", "activity": "D-threo-isocitrate + NADP(+) = 2-oxoglutarate + CO2 + NADPH.", "evidence": [ { "id": "B7Z0E0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B7Z0E0" } ] }, { "ec_number": "1.1.1.42", "activity": "", "evidence": [ { "id": "B7Z0E0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B7Z0E0" } ] } ] }, { "uniprot_ac": "M9NDS9", "gene_name": "Cht6", "activity": [ { "ec_number": "3.2.1.14", "activity": "Random endo-hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.", "evidence": [ { "id": "M9NDS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M9NDS9" } ] } ] }, { "uniprot_ac": "O76895", "gene_name": "arg", "activity": [ { "ec_number": "3.5.3.1", "activity": "H2O + L-arginine = L-ornithine + urea.", "evidence": [ { "id": "O76895", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76895" } ] }, { "ec_number": "3.5.3.1", "activity": "", "evidence": [ { "id": "O76895", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76895" } ] } ] }, { "uniprot_ac": "P07764", "gene_name": "Ald1", "activity": [ { "ec_number": "4.1.2.13", "activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.", "evidence": [ { "id": "P07764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07764" } ] }, { "ec_number": "4.1.2.13", "activity": "", "evidence": [ { "id": "P07764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07764" } ] } ] }, { "uniprot_ac": "P29349", "gene_name": "csw", "activity": [ { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P29349", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29349" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P29349", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29349" } ] } ] }, { "uniprot_ac": "P29615", "gene_name": "LysP", "activity": [ { "ec_number": "3.2.1.17", "activity": "Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.", "evidence": [ { "id": "P29615", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29615" } ] }, { "ec_number": "3.2.1.17", "activity": "", "evidence": [ { "id": "P29615", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29615" } ] } ] }, { "uniprot_ac": "P37159", "gene_name": "LysE", "activity": [ { "ec_number": "3.2.1.17", "activity": "Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.", "evidence": [ { "id": "P37159", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P37159" } ] }, { "ec_number": "3.2.1.17", "activity": "", "evidence": [ { "id": "P37159", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P37159" } ] } ] }, { "uniprot_ac": "P37160", "gene_name": "LysS", "activity": [ { "ec_number": "3.2.1.17", "activity": "Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.", "evidence": [ { "id": "P37160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P37160" } ] }, { "ec_number": "3.2.1.17", "activity": "", "evidence": [ { "id": "P37160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P37160" } ] } ] }, { "uniprot_ac": "P37161", "gene_name": "LysX", "activity": [ { "ec_number": "3.2.1.17", "activity": "Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.", "evidence": [ { "id": "P37161", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P37161" } ] }, { "ec_number": "3.2.1.17", "activity": "", "evidence": [ { "id": "P37161", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P37161" } ] } ] }, { "uniprot_ac": "P40417", "gene_name": "rl", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P40417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40417" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P40417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40417" } ] } ] }, { "uniprot_ac": "P83099", "gene_name": "Pkcdelta", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P83099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83099" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P83099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83099" } ] }, { "ec_number": "2.7.11.-", "activity": "", "evidence": [ { "id": "P83099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83099" } ] } ] }, { "uniprot_ac": "P83972", "gene_name": "LysD", "activity": [ { "ec_number": "3.2.1.17", "activity": "Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.", "evidence": [ { "id": "P83972", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83972" } ] }, { "ec_number": "3.2.1.17", "activity": "", "evidence": [ { "id": "P83972", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83972" } ] } ] }, { "uniprot_ac": "Q07152", "gene_name": "ras", "activity": [ { "ec_number": "1.1.1.205", "activity": "H2O + IMP + NAD(+) = H(+) + NADH + XMP.", "evidence": [ { "id": "Q07152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07152" } ] }, { "ec_number": "1.1.1.205", "activity": "", "evidence": [ { "id": "Q07152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07152" } ] } ] }, { "uniprot_ac": "Q08694", "gene_name": "LysB", "activity": [ { "ec_number": "3.2.1.17", "activity": "Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.", "evidence": [ { "id": "Q08694", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08694" } ] }, { "ec_number": "3.2.1.17", "activity": "", "evidence": [ { "id": "Q08694", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08694" } ] } ] }, { "uniprot_ac": "Q0E8H9", "gene_name": "Hexo1", "activity": [ { "ec_number": "3.2.1.52", "activity": "Hydrolysis of terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides.", "evidence": [ { "id": "Q0E8H9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0E8H9" } ] }, { "ec_number": "3.2.1.52", "activity": "", "evidence": [ { "id": "Q0E8H9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0E8H9" } ] } ] }, { "uniprot_ac": "Q7JQR3", "gene_name": "Qsox1", "activity": [ { "ec_number": "1.8.3.2", "activity": "O2 + 2 R'C(R)SH = H2O2 + R'C(R)S-S(R)CR'.", "evidence": [ { "id": "Q7JQR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JQR3" } ] }, { "ec_number": "1.8.3.2", "activity": "", "evidence": [ { "id": "Q7JQR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JQR3" } ] } ] }, { "uniprot_ac": "Q7K485", "gene_name": "cathD", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q7K485", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K485" } ] } ] }, { "uniprot_ac": "Q7KN62", "gene_name": "TER94", "activity": [ { "ec_number": "3.6.4.6", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q7KN62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KN62" } ] }, { "ec_number": "3.6.4.6", "activity": "", "evidence": [ { "id": "Q7KN62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KN62" } ] } ] }, { "uniprot_ac": "Q7KN85", "gene_name": "ATPCL", "activity": [ { "ec_number": "2.3.3.8", "activity": "acetyl-CoA + ADP + oxaloacetate + phosphate = ATP + citrate + CoA.", "evidence": [ { "id": "Q7KN85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KN85" } ] }, { "ec_number": "2.3.3.8", "activity": "", "evidence": [ { "id": "Q7KN85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KN85" } ] } ] }, { "uniprot_ac": "Q7KN92", "gene_name": "beta4GalNAcTA", "activity": [ { "ec_number": "2.4.1.244", "activity": "an N-acetyl-beta-D-glucosaminyl derivative + UDP-N-acetyl-alpha-D-galactosamine = an N-acetyl-beta-D-galactosaminyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q7KN92", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KN92" } ] } ] }, { "uniprot_ac": "Q7KRU8", "gene_name": "Fer1HCH", "activity": [ { "ec_number": "1.16.3.1", "activity": "4 Fe(2+) + 4 H(+) + O2 = 4 Fe(3+) + 2 H2O.", "evidence": [ { "id": "Q7KRU8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KRU8" } ] }, { "ec_number": "1.16.3.1", "activity": "", "evidence": [ { "id": "Q7KRU8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KRU8" } ] } ] }, { "uniprot_ac": "Q7KUC2", "gene_name": "Pdxk", "activity": [ { "ec_number": "2.7.1.35", "activity": "ATP + pyridoxal = ADP + H(+) + pyridoxal 5'-phosphate.", "evidence": [ { "id": "Q7KUC2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KUC2" } ] }, { "ec_number": "2.7.1.35", "activity": "", "evidence": [ { "id": "Q7KUC2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KUC2" } ] } ] }, { "uniprot_ac": "Q86PD7", "gene_name": "isoQC", "activity": [ { "ec_number": "2.3.2.5", "activity": "N-terminal L-glutaminyl-[peptide] = N-terminal 5-oxo-L-prolyl-[peptide] + NH4(+).", "evidence": [ { "id": "Q86PD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86PD7" } ] }, { "ec_number": "2.3.2.5", "activity": "", "evidence": [ { "id": "Q86PD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86PD7" } ] } ] }, { "uniprot_ac": "Q8IPB7", "gene_name": "LManII", "activity": [ { "ec_number": "3.2.1.-", "activity": "", "evidence": [ { "id": "Q8IPB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IPB7" } ] } ] }, { "uniprot_ac": "Q8IQM9", "gene_name": "l(3)72Dp", "activity": [ { "ec_number": "3.4.19.9", "activity": "(6S)-5,6,7,8-tetrahydrofolyl-(gamma-L-Glu)(n) + (n-1) H2O = (6S)-5,6,7,8-tetrahydrofolate + (n-1) L-glutamate.", "evidence": [ { "id": "Q8IQM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IQM9" } ] }, { "ec_number": "3.4.19.9", "activity": "", "evidence": [ { "id": "Q8IQM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IQM9" } ] } ] }, { "uniprot_ac": "Q8MPP3", "gene_name": "Mmp2", "activity": [ { "ec_number": "3.4.24.-", "activity": "", "evidence": [ { "id": "Q8MPP3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MPP3" } ] } ] }, { "uniprot_ac": "Q8MR45", "gene_name": "", "activity": [ { "ec_number": "3.5.1.26", "activity": "H2O + N(4)-(beta-N-acetyl-D-glucosaminyl)-L-asparagine = H(+) + L-aspartate + N-acetyl-beta-D-glucosaminylamine.", "evidence": [ { "id": "Q8MR45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MR45" } ] }, { "ec_number": "3.5.1.26", "activity": "", "evidence": [ { "id": "Q8MR45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MR45" } ] } ] }, { "uniprot_ac": "Q8WSF3", "gene_name": "fdl", "activity": [ { "ec_number": "3.2.1.52", "activity": "Hydrolysis of terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides.", "evidence": [ { "id": "Q8WSF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WSF3" } ] }, { "ec_number": "3.2.1.52", "activity": "", "evidence": [ { "id": "Q8WSF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WSF3" } ] } ] }, { "uniprot_ac": "Q95029", "gene_name": "Cp1", "activity": [ { "ec_number": "3.4.22.15", "activity": "Specificity close to that of papain. As compared to cathepsin B, cathepsin L exhibits higher activity toward protein substrates, but has little activity on Z-Arg-Arg-NHMec, and no peptidyl-dipeptidase activity.", "evidence": [ { "id": "Q95029", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95029" } ] }, { "ec_number": "3.4.22.15", "activity": "", "evidence": [ { "id": "Q95029", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95029" } ] }, { "ec_number": "3.4.-.-", "activity": "", "evidence": [ { "id": "Q95029", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95029" } ] }, { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q95029", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95029" } ] } ] }, { "uniprot_ac": "Q95TL8", "gene_name": "ERp44", "activity": [ { "ec_number": "5.3.4.1", "activity": "Catalyzes the rearrangement of -S-S- bonds in proteins.", "evidence": [ { "id": "Q95TL8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95TL8" } ] } ] }, { "uniprot_ac": "Q9V420", "gene_name": "Su(P)", "activity": [ { "ec_number": "5.3.99.3", "activity": "prostaglandin H2 = prostaglandin E2.", "evidence": [ { "id": "Q9V420", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V420" } ] }, { "ec_number": "5.3.99.3", "activity": "", "evidence": [ { "id": "Q9V420", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V420" } ] } ] }, { "uniprot_ac": "Q9V9J3", "gene_name": "Src42A", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "Q9V9J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V9J3" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "Q9V9J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V9J3" } ] } ] }, { "uniprot_ac": "Q9VA83", "gene_name": "Fer2LCH", "activity": [ { "ec_number": "1.16.3.1", "activity": "4 Fe(2+) + 4 H(+) + O2 = 4 Fe(3+) + 2 H2O.", "evidence": [ { "id": "Q9VA83", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VA83" } ] }, { "ec_number": "1.16.3.1", "activity": "", "evidence": [ { "id": "Q9VA83", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VA83" } ] } ] }, { "uniprot_ac": "Q9VAQ8", "gene_name": "beta4GalNAcTB", "activity": [ { "ec_number": "2.4.1.244", "activity": "an N-acetyl-beta-D-glucosaminyl derivative + UDP-N-acetyl-alpha-D-galactosamine = an N-acetyl-beta-D-galactosaminyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q9VAQ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VAQ8" } ] } ] }, { "uniprot_ac": "Q9VBF5", "gene_name": "Ald2", "activity": [ { "ec_number": "4.1.2.13", "activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.", "evidence": [ { "id": "Q9VBF5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VBF5" } ] }, { "ec_number": "4.1.2.13", "activity": "", "evidence": [ { "id": "Q9VBF5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VBF5" } ] } ] }, { "uniprot_ac": "Q9VGE7", "gene_name": "Ect3", "activity": [ { "ec_number": "3.2.1.23", "activity": "Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides.", "evidence": [ { "id": "Q9VGE7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGE7" } ] }, { "ec_number": "3.2.1.23", "activity": "", "evidence": [ { "id": "Q9VGE7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGE7" } ] } ] }, { "uniprot_ac": "Q9VGN8", "gene_name": "Dmel\\CG5276", "activity": [ { "ec_number": "3.6.1.15", "activity": "a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate.", "evidence": [ { "id": "Q9VGN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGN8" } ] }, { "ec_number": "3.6.1.6", "activity": "ADP + H2O = AMP + H(+) + phosphate.", "evidence": [ { "id": "Q9VGN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGN8" } ] }, { "ec_number": "3.6.1.42", "activity": "GDP + H2O = GMP + H(+) + phosphate.", "evidence": [ { "id": "Q9VGN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGN8" } ] } ] }, { "uniprot_ac": "Q9VJ39", "gene_name": "pepCG10602", "activity": [ { "ec_number": "3.3.2.6", "activity": "H2O + leukotriene A4 = leukotriene B4.", "evidence": [ { "id": "Q9VJ39", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ39" } ] }, { "ec_number": "3.3.2.6", "activity": "", "evidence": [ { "id": "Q9VJ39", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ39" } ] } ] }, { "uniprot_ac": "Q9VLK3", "gene_name": "Bace", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q9VLK3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VLK3" } ] } ] }, { "uniprot_ac": "Q9VLR2", "gene_name": "Dmel\\CG8353", "activity": [ { "ec_number": "3.5.4.5", "activity": "2'-deoxycytidine + H(+) + H2O = 2'-deoxyuridine + NH4(+).", "evidence": [ { "id": "Q9VLR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VLR2" } ] }, { "ec_number": "3.5.4.5", "activity": "", "evidence": [ { "id": "Q9VLR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VLR2" } ] } ] }, { "uniprot_ac": "Q9VNK6", "gene_name": "Dmel\\CG11459", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q9VNK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VNK6" } ] } ] }, { "uniprot_ac": "Q9VQ11", "gene_name": "Dmel\\CG31928", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q9VQ11", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VQ11" } ] } ] }, { "uniprot_ac": "Q9VQ13", "gene_name": "Dmel\\CG31926", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q9VQ13", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VQ13" } ] } ] }, { "uniprot_ac": "Q9VQI7", "gene_name": "Prx6a", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "Q9VQI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VQI7" } ] } ] }, { "uniprot_ac": "Q9VQX4", "gene_name": "Naprt", "activity": [ { "ec_number": "6.3.4.21", "activity": "5-phospho-alpha-D-ribose 1-diphosphate + ATP + H2O + nicotinate = ADP + diphosphate + nicotinate beta-D-ribonucleotide + phosphate.", "evidence": [ { "id": "Q9VQX4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VQX4" } ] }, { "ec_number": "6.3.4.21", "activity": "", "evidence": [ { "id": "Q9VQX4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VQX4" } ] } ] }, { "uniprot_ac": "Q9VSC3", "gene_name": "RNaseX25", "activity": [ { "ec_number": "4.6.1.19", "activity": "a ribonucleotidyl-ribonucleotide-RNA + H2O = a 3'-end 3'-phospho-ribonucleotide-RNA + a 5'-end dephospho-ribonucleoside-RNA + H(+).", "evidence": [ { "id": "Q9VSC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VSC3" } ] } ] }, { "uniprot_ac": "Q9VTJ4", "gene_name": "Fuca", "activity": [ { "ec_number": "3.2.1.51", "activity": "an alpha-L-fucoside + H2O = an alcohol + L-fucose.", "evidence": [ { "id": "Q9VTJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VTJ4" } ] }, { "ec_number": "3.2.1.51", "activity": "", "evidence": [ { "id": "Q9VTJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VTJ4" } ] } ] }, { "uniprot_ac": "Q9VUY9", "gene_name": "Pgm1", "activity": [ { "ec_number": "5.4.2.2", "activity": "alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.", "evidence": [ { "id": "Q9VUY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VUY9" } ] }, { "ec_number": "5.4.2.2", "activity": "", "evidence": [ { "id": "Q9VUY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VUY9" } ] } ] }, { "uniprot_ac": "Q9VVK5", "gene_name": "Adgf-A", "activity": [ { "ec_number": "3.5.4.4", "activity": "2'-deoxyadenosine + H(+) + H2O = 2'-deoxyinosine + NH4(+).", "evidence": [ { "id": "Q9VVK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VVK5" } ] }, { "ec_number": "3.5.4.4", "activity": "", "evidence": [ { "id": "Q9VVK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VVK5" } ] } ] }, { "uniprot_ac": "Q9VYH1", "gene_name": "Fer3HCH", "activity": [ { "ec_number": "1.16.3.1", "activity": "4 Fe(2+) + 4 H(+) + O2 = 4 Fe(3+) + 2 H2O.", "evidence": [ { "id": "Q9VYH1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VYH1" } ] }, { "ec_number": "1.16.3.1", "activity": "", "evidence": [ { "id": "Q9VYH1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VYH1" } ] } ] }, { "uniprot_ac": "Q9VZV2", "gene_name": "Cht7", "activity": [ { "ec_number": "3.2.1.14", "activity": "Random endo-hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.", "evidence": [ { "id": "Q9VZV2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VZV2" } ] } ] }, { "uniprot_ac": "Q9VZZ4", "gene_name": "Pxn", "activity": [ { "ec_number": "1.11.2.-", "activity": "", "evidence": [ { "id": "Q9VZZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VZZ4" } ] } ] }, { "uniprot_ac": "Q9W122", "gene_name": "Mmp1", "activity": [ { "ec_number": "3.4.24.-", "activity": "", "evidence": [ { "id": "Q9W122", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W122" } ] } ] }, { "uniprot_ac": "Q9W3C4", "gene_name": "Hexo2", "activity": [ { "ec_number": "3.2.1.52", "activity": "Hydrolysis of terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides.", "evidence": [ { "id": "Q9W3C4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W3C4" } ] }, { "ec_number": "3.2.1.52", "activity": "", "evidence": [ { "id": "Q9W3C4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W3C4" } ] } ] }, { "uniprot_ac": "Q9W5G3", "gene_name": "Pgcl", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q9W5G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W5G3" } ] } ] }, { "uniprot_ac": "X2JGK6", "gene_name": "Dmel\\CG5946", "activity": [ { "ec_number": "1.6.2.2", "activity": "2 Fe(III)-[cytochrome b5] + NADH = 2 Fe(II)-[cytochrome b5] + H(+) + NAD(+).", "evidence": [ { "id": "X2JGK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/X2JGK6" } ] }, { "ec_number": "1.6.2.2", "activity": "", "evidence": [ { "id": "X2JGK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/X2JGK6" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }