{ "uniprot_canonical_ac": "A1Z739-1", "uniprot_ac": "A1Z739", "uniprot_id": "A1Z739_DROME", "mass": { "chemical_mass": 40206.0, "monoisotopic_mass": 40206.0 }, "refseq": { "ac": "NP_610319", "name": "uncharacterized protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610319" }, "gene_names": [ { "name": "Dmel\\CG1946", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A1Z739", "id": "A1Z739" }, { "name": "CG1946-RA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A1Z739", "id": "A1Z739" }, { "name": "CG1946", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610319", "id": "NP_610319" }, { "name": "CG1946", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A1Z739", "id": "A1Z739" }, { "name": "Dmel\\CG1946", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610319", "id": "NP_610319" }, { "name": "Dmel_CG1946", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A1Z739", "id": "A1Z739" } ], "protein_names": [ { "name": "Acyltransferase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A1Z739" }, { "name": "2.3.1.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A1Z739" }, { "name": "CG1946-PA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610319", "id": "NP_610319" }, { "name": "uncharacterized protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610319", "id": "NP_610319" } ], "function": [], "disease": [ { "disease_id": "DOID:0080208", "recommended_name": { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "metabolic dysfunction-associated steatotic liver disease", "description": "A steatotic liver disease characterized by at least one of five cardiometabolic risk factors (adjusted for age, sex and ethnicity), alcohol consumption below 140g/week (female) or 210g/week (male), and no other discernible cause. The five cardiometabolic risk factors are:(1) Body mass index 25 kg/m2 (adult), 23 kg/m2 (adult Asian), or 85th percentile (pediatric); waist circumference > 94 cm (adult male), 80 cm (adult female), or 95th percentile (pediatric); or ethnicity adjusted equivalents.(2) Fasting serum glucose 5.6 mmol/L, 2-hr post-load glucose levels 7.8 mmol/L, glycated hemoglobin (HbA1c) 5.7% (39 mmol/L), type 2 diabetes, treatment for type 2 diabetes, previously diagnosed or treated type 2 diabetes (pediatric only), or serum glucose 11.1 mmol/L (pediatric only).(3) Blood pressure lower of 130/85 mmHg or 95th percentile (age < 13 years), or 130/85 mmHg (age 13 years); or specific hypertensive drug treatment.(4) Plasma triglycerides 1.15 mmol/L (age < 10 years) or 1.70 mmol/L (age 10 years); or lipid lowering treatment.(5) Plasma high-density lipoprotein cholesterol 1.0 mmol/L (adult male, pediatric) or 1.3 mmol/L (adult female); or lipid lowering treatment." }, "synonyms": [ { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "non-alcoholic fatty liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "NAFLD", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "metabolic dysfunction-associated fatty liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "metabolic dysfunction-related steatotic liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "MAFLD", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "MASLD", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "metabolic-associated fatty liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "nonalcoholic fatty liver disease", "description": "" }, { "id": "MONDO:0013246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013246", "name": "fatty liver disease, nonalcoholic, susceptibility to, 2", "description": "" }, { "id": "MONDO:0013246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013246", "name": "NAFLD2", "description": "" }, { "id": "MONDO:0013246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013246", "name": "fatty liver disease, nonalcoholic, susceptibility to, 2", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "NAFLD1", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "NAFLD1", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "fatty liver disease, nonalcoholic, susceptibility to, 1", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "liver disease, alcoholic, susceptibility to, 1", "description": "" }, { "id": "MIM:613282", "resource": "MIM", "url": "https://www.omim.org/entry/613282", "name": "Non-alcoholic fatty liver disease 1", "description": "Non-alcoholic fatty liver disease 1" } ], "evidence": [ { "id": "0080208", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080208" } ] }, { "disease_id": "DOID:10787", "recommended_name": { "id": "DOID:10787", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10787", "name": "premature menopause", "description": "An ovarian dysfunction that is the loss of normal ovarian function before age 40." }, "synonyms": [ { "id": "DOID:10787", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10787", "name": "Menopause - premature", "description": "" }, { "id": "DOID:10787", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10787", "name": "Menopause praecox", "description": "" } ], "evidence": [ { "id": "10787", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10787" } ] }, { "disease_id": "DOID:784", "recommended_name": { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "chronic kidney disease", "description": "A kidney failure that is characterized by the gradual loss of kidney function." }, "synonyms": [ { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "CKD", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "CRF", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "chronic kidney failure", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "chronic renal disease", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "chronic renal failure syndrome", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "renal failure - chronic", "description": "" } ], "evidence": [ { "id": "784", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:784" } ] }, { "disease_id": "DOID:9452", "recommended_name": { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "steatotic liver disease", "description": "A lipid storage disease characterized by the accumulation of large vacuoles of triglyceride fat in at least 5% of hepatocytes." }, "synonyms": [ { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "SLD", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "fatty liver disease", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "Fatty change of liver", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "Steatosis of liver", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "alcoholic fatty liver", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "hepatic lipidosis", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "hepatic steatosis", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "visceral steatosis, congenital", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "visceral steatosis, congenital", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "White liver disease", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "fatal neonatal hepatic steatosis", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "fatty liver disease, congenital", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "fatty metamorphosis of viscera", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "steatosis of liver", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "visceral steatosis", "description": "" } ], "evidence": [ { "id": "9452", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9452" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "A1Z739", "url": "https://www.uniprot.org/uniprot/A1Z739" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "Dmel\\CG1946", "url": "https://www.uniprot.org/uniprot/A1Z739", "locus": { "chromosome": "2R", "start_pos": 7716781, "end_pos": 7714923, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0033216", "url": "https://www.ensembl.org/id/FBgn0033216" } ] } } ], "crossref": [ { "id": "FBgn0033216", "url": "https://bgee.org/?page=gene&gene_id=FBgn0033216", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd07987", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07987", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0033216", "url": "https://flybase.org/reports/FBgn0033216", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "35720", "url": "https://www.ncbi.nlm.nih.gov/gene/35720", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR007130", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007130", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG1946", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG1946", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "WMWLILF", "url": "https://omabrowser.org/oma/group/WMWLILF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "601258at2759", "url": "http://www.orthodb.org/?query=601258at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12317", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12317", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12317:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12317:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03982", "url": "http://pfam.xfam.org/family/PF03982", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-DME-1482883", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-1482883", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-2142753", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-2142753", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-2187335", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-75109", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-75109", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-9640463", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9640463", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_610319", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610319", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A1Z739", "url": "https://www.uniprot.org/uniprot/A1Z739", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A1Z739-1", "url": "https://www.uniprot.org/uniprot/A1Z739-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTIEWAPLRVPLERRLQTLVTSFFTYTFFTLPISSCLAVAILLYYGEMFVRSLLLIYFVKIYLDYKRNYGIMEGNGWLFYRSNWRYRNYFPVELVKTAELPPNRNYIVASFPHGILGTGTCINMSLDIDNWLSLYPHVRPKIATLDHHFKTPFLRDILRWWGMVSVSKESLSYLLSKSNDPMHKDNRDGFTSNAVAVLVGGAKEAMDSHPGQYILTLKDRKGFVKMAVRTGSSIVPSLSFGEVDIFDQVANPPDSSLRRFQNVVKKFTGISPLLPKGRGIFNYNYGILPHRRRIVQVVGSPIDVERCETPDPEYVDKIHGQVIDALARMFDEYKEKYTPNSKHIKLIIQ", "length": 349, "header": "tr|A1Z739-1|A1Z739_DROME Isoform 1 of Acyltransferase OS=Drosophila melanogaster OX=7227 GN=Dmel\\CG1946 PE=2 SV=2 CANONICAL=A1Z739-1" }, "isoforms": [ { "isoform_ac": "A1Z739-1", "url": "", "sequence": { "sequence": "MTIEWAPLRVPLERRLQTLVTSFFTYTFFTLPISSCLAVAILLYYGEMFVRSLLLIYFVKIYLDYKRNYGIMEGNGWLFYRSNWRYRNYFPVELVKTAELPPNRNYIVASFPHGILGTGTCINMSLDIDNWLSLYPHVRPKIATLDHHFKTPFLRDILRWWGMVSVSKESLSYLLSKSNDPMHKDNRDGFTSNAVAVLVGGAKEAMDSHPGQYILTLKDRKGFVKMAVRTGSSIVPSLSFGEVDIFDQVANPPDSSLRRFQNVVKKFTGISPLLPKGRGIFNYNYGILPHRRRIVQVVGSPIDVERCETPDPEYVDKIHGQVIDALARMFDEYKEKYTPNSKHIKLIIQ", "length": 349, "header": "tr|A1Z739-1|A1Z739_DROME Isoform 1 of Acyltransferase OS=Drosophila melanogaster OX=7227 GN=Dmel\\CG1946 PE=2 SV=2 CANONICAL=A1Z739-1" }, "locus": { "chromosome": "2R", "start_pos": 7716699, "end_pos": 7714983, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0088929", "url": "https://www.ensembl.org/id/FBtr0088929" }, { "database": "Ensembl Peptide", "id": "FBpp0088003", "url": "https://www.ensembl.org/id/FBpp0088003" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "A1Z739", "url": "https://www.uniprot.org/uniprot/A1Z739" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.", "journal": "Genome Biol.", "date": "2002", "authors": "Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP, Frise E, Hodgson A, George RA, Hoskins RA, Laverty T, Muzny DM, Nelson CR, Pacleb JM, Park S, Pfeiffer BD, Richards S, Sodergren EJ, Svirskas R, Tabor PE, Wan K, Stapleton M, Sutton GG, Venter C, Weinstock G, Scherer SE, Myers EW, Gibbs RA, Rubin GM", "evidence": [ { "database": "UniProtKB", "id": "A1Z739", "url": "https://www.uniprot.org/uniprot/A1Z739" } ], "reference": [ { "type": "PubMed", "id": "12537568", "url": "https://glygen.org/publication/PubMed/12537568" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "A1Z739", "url": "https://www.uniprot.org/uniprot/A1Z739" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.", "journal": "Genome Biol.", "date": "2002", "authors": "Kaminker JS, Bergman CM, Kronmiller B, Carlson J, Svirskas R, Patel S, Frise E, Wheeler DA, Lewis SE, Rubin GM, Ashburner M, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "A1Z739", "url": "https://www.uniprot.org/uniprot/A1Z739" } ], "reference": [ { "type": "PubMed", "id": "12537573", "url": "https://glygen.org/publication/PubMed/12537573" } ] }, { "title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.", "journal": "Genome Biol.", "date": "2002", "authors": "Hoskins RA, Smith CD, Carlson JW, Carvalho AB, Halpern A, Kaminker JS, Kennedy C, Mungall CJ, Sullivan BA, Sutton GG, Yasuhara JC, Wakimoto BT, Myers EW, Celniker SE, Rubin GM, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "A1Z739", "url": "https://www.uniprot.org/uniprot/A1Z739" } ], "reference": [ { "type": "PubMed", "id": "12537574", "url": "https://glygen.org/publication/PubMed/12537574" } ] }, { "title": "Combined evidence annotation of transposable elements in genome sequences.", "journal": "PLoS Comput. Biol.", "date": "2005", "authors": "Quesneville H, Bergman CM, Andrieu O, Autard D, Nouaud D, Ashburner M, Anxolabehere D", "evidence": [ { "database": "UniProtKB", "id": "A1Z739", "url": "https://www.uniprot.org/uniprot/A1Z739" } ], "reference": [ { "type": "PubMed", "id": "16110336", "url": "https://glygen.org/publication/PubMed/16110336" } ] }, { "title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Smith CD, Shu S, Mungall CJ, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "A1Z739", "url": "https://www.uniprot.org/uniprot/A1Z739" } ], "reference": [ { "type": "PubMed", "id": "17569856", "url": "https://glygen.org/publication/PubMed/17569856" } ] }, { "title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Hoskins RA, Carlson JW, Kennedy C, Acevedo D, Evans-Holm M, Frise E, Wan KH, Park S, Mendez-Lago M, Rossi F, Villasante A, Dimitri P, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "A1Z739", "url": "https://www.uniprot.org/uniprot/A1Z739" } ], "reference": [ { "type": "PubMed", "id": "17569867", "url": "https://glygen.org/publication/PubMed/17569867" } ] }, { "title": "The Release 6 reference sequence of the Drosophila melanogaster genome.", "journal": "Genome Res.", "date": "2015", "authors": "Hoskins RA, Carlson JW, Wan KH, Park S, Mendez I, Galle SE, Booth BW, Pfeiffer BD, George RA, Svirskas R, Krzywinski M, Schein J, Accardo MC, Damia E, Messina G, Mendez-Lago M, de Pablos B, Demakova OV, Andreyeva EN, Boldyreva LV, Marra M, Carvalho AB, Dimitri P, Villasante A, Zhimulev IF, Rubin GM, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "A1Z739", "url": "https://www.uniprot.org/uniprot/A1Z739" } ], "reference": [ { "type": "PubMed", "id": "25589440", "url": "https://glygen.org/publication/PubMed/25589440" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: The Rule-Benders.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Crosby MA, Gramates LS, Dos Santos G, Matthews BB, St Pierre SE, Zhou P, Schroeder AJ, Falls K, Emmert DB, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "A1Z739", "url": "https://www.uniprot.org/uniprot/A1Z739" } ], "reference": [ { "type": "PubMed", "id": "26109356", "url": "https://glygen.org/publication/PubMed/26109356" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Matthews BB, Dos Santos G, Crosby MA, Emmert DB, St Pierre SE, Gramates LS, Zhou P, Schroeder AJ, Falls K, Strelets V, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "A1Z739", "url": "https://www.uniprot.org/uniprot/A1Z739" } ], "reference": [ { "type": "PubMed", "id": "26109357", "url": "https://glygen.org/publication/PubMed/26109357" } ] } ], "pathway": [ { "id": "dme:Dmel_CG1946", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG1946", "resource": "KEGG Pathway" }, { "id": "R-DME-1482883", "name": "Acyl chain remodeling of DAG and TAG", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-1482883", "resource": "Reactome", "description": "Acyl chain remodeling of DAG and TAG" }, { "id": "R-DME-2142753", "name": "Arachidonic acid metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-2142753", "resource": "Reactome", "description": "Arachidonic acid metabolism" }, { "id": "R-DME-2187335", "name": "The retinoid cycle in cones (daylight vision)", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-2187335", "resource": "Reactome", "description": "The retinoid cycle in cones (daylight vision)" }, { "id": "R-DME-75109", "name": "Triglyceride biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-75109", "resource": "Reactome", "description": "Triglyceride biosynthesis" }, { "id": "R-DME-9640463", "name": "Wax biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9640463", "resource": "Reactome", "description": "Wax biosynthesis" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "A1Z739", "url": "https://www.uniprot.org/uniprot/A1Z739" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "triglyceride biosynthetic process", "id": "GO:0019432", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019432", "evidence": [ { "database": "UniProtKB", "id": "A1Z739", "url": "https://www.uniprot.org/uniprot/A1Z739" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "diacylglycerol O-acyltransferase activity", "id": "GO:0004144", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004144", "evidence": [ { "database": "UniProtKB", "id": "A1Z739", "url": "https://www.uniprot.org/uniprot/A1Z739" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 123, "end_pos": 125, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-DME-1482889", "name": "DAG is acylated to TAG by DGAT1/2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A1Z739-1", "Q7JYK2-1", "Q7K1C2-1" ], "evidence": [ { "id": "R-DME-1482889", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-1482889" } ] }, { "id": "R-DME-2465919", "name": "AWAT2 transfers PALM to 11cROL forming 11cRPALM", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A1Z739-1", "Q7JYK2-1", "Q7K1C2-1" ], "evidence": [ { "id": "R-DME-2465919", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-2465919" } ] }, { "id": "R-DME-549192", "name": "1,2-diacyl-glycerol + acyl-CoA => triacylglycerol + CoASH [DGAT2]", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A1Z739-1", "Q7JYK2-1", "Q7K1C2-1" ], "evidence": [ { "id": "R-DME-549192", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-549192" } ] }, { "id": "R-DME-5696424", "name": "AWAT1 transfers acyl group from acyl-CoA to ARACOH, forming wax esters", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-192172", "R-ALL-5696426" ], "output_participant_list": [ "R-ALL-5696412" ], "enzyme_list": [ "A1Z739-1", "Q7JYK2-1", "Q7K1C2-1" ], "evidence": [ { "id": "R-DME-5696424", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5696424" } ] }, { "id": "R-DME-5696448", "name": "AWAT2 transfers acyl group from acyl-CoA to MAG, forming DAG", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-5696449", "R-ALL-6782195" ], "output_participant_list": [], "enzyme_list": [ "A1Z739-1", "Q7JYK2-1", "Q7K1C2-1" ], "evidence": [ { "id": "R-DME-5696448", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5696448" } ] }, { "id": "R-DME-6800334", "name": "MOGAT1,2,3 transfer acyl group from acyl-CoA to 2-acylglycerol to form DAG", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-6800352" ], "output_participant_list": [], "enzyme_list": [ "A1Z739-1", "Q7JYK2-1", "Q7K1C2-1" ], "evidence": [ { "id": "R-DME-6800334", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-6800334" } ] }, { "id": "R-DME-8848580", "name": "DGAT2L6,L7P transfer acyl group from acyl-CoA to DAG, forming TAG", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A1Z739-1", "Q7JYK2-1", "Q7K1C2-1" ], "evidence": [ { "id": "R-DME-8848580", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-8848580" } ] }, { "id": "R-DME-8848582", "name": "AWAT2 transfers PALM from PALM-CoA to HXOL, forming palmityl palmitate ester", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-8848577" ], "output_participant_list": [ "R-ALL-8848499" ], "enzyme_list": [ "A1Z739-1", "Q7JYK2-1", "Q7K1C2-1" ], "evidence": [ { "id": "R-DME-8848582", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-8848582" } ] }, { "id": "R-DME-8848585", "name": "AWAT2 transfers PALM from PALM-CoA to atROL, forming atR-PALM", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-30209" ], "output_participant_list": [ "R-ALL-2534407" ], "enzyme_list": [ "A1Z739-1", "Q7JYK2-1", "Q7K1C2-1" ], "evidence": [ { "id": "R-DME-8848585", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-8848585" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-192172", "participant_name": "Acyl-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "C00040", "database": "COMPOUND", "url": "" }, { "id": "17984", "database": "ChEBI", "url": "" }, { "id": "C00040", "database": "COMPOUND", "url": "" }, { "id": "17984", "database": "ChEBI", "url": "" }, { "id": "C00040", "database": "COMPOUND", "url": "" }, { "id": "17984", "database": "ChEBI", "url": "" }, { "id": "C00040", "database": "COMPOUND", "url": "" }, { "id": "17984", "database": "ChEBI", "url": "" }, { "id": "17984", "database": "ChEBI", "url": "" }, { "id": "C00040", "database": "COMPOUND", "url": "" }, { "id": "C00040", "database": "COMPOUND", "url": "" }, { "id": "17984", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2534407", "participant_name": "atR-PALM [cytosol]", "crossref": [ { "id": "17616", "database": "ChEBI", "url": "" }, { "id": "000008214494", "database": "ZINC", "url": "" }, { "id": "C02588", "database": "COMPOUND", "url": "" }, { "id": "HMDB0003648", "database": "HMDB Metabolite", "url": "" }, { "id": "17616", "database": "ChEBI", "url": "" }, { "id": "000008214494", "database": "ZINC", "url": "" }, { "id": "C02588", "database": "COMPOUND", "url": "" }, { "id": "HMDB0003648", "database": "HMDB Metabolite", "url": "" }, { "id": "17616", "database": "ChEBI", "url": "" }, { "id": "000008214494", "database": "ZINC", "url": "" }, { "id": "C02588", "database": "COMPOUND", "url": "" }, { "id": "HMDB0003648", "database": "HMDB Metabolite", "url": "" }, { "id": "17616", "database": "ChEBI", "url": "" }, { "id": "000008214494", "database": "ZINC", "url": "" }, { "id": "C02588", "database": "COMPOUND", "url": "" }, { "id": "HMDB0003648", "database": "HMDB Metabolite", "url": "" }, { "id": "000008214494", "database": "ZINC", "url": "" }, { "id": "HMDB0003648", "database": "HMDB Metabolite", "url": "" }, { "id": "17616", "database": "ChEBI", "url": "" }, { "id": "C02588", "database": "COMPOUND", "url": "" }, { "id": "17616", "database": "ChEBI", "url": "" }, { "id": "000008214494", "database": "ZINC", "url": "" }, { "id": "C02588", "database": "COMPOUND", "url": "" }, { "id": "HMDB0003648", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-30209", "participant_name": "atROL [cytosol]", "crossref": [ { "id": "C00473", "database": "COMPOUND", "url": "" }, { "id": "17336", "database": "ChEBI", "url": "" }, { "id": "HMDB0000305", "database": "HMDB Metabolite", "url": "" }, { "id": "8144182", "database": "PubChem Substance", "url": "" }, { "id": "000003831417", "database": "ZINC", "url": "" }, { "id": "4053", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "8144182", "database": "PubChem Substance", "url": "" }, { "id": "4053", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "17336", "database": "ChEBI", "url": "" }, { "id": "C00473", "database": "COMPOUND", "url": "" }, { "id": "000003831417", "database": "ZINC", "url": "" }, { "id": "HMDB0000305", "database": "HMDB Metabolite", "url": "" }, { "id": "HMDB0000305", "database": "HMDB Metabolite", "url": "" }, { "id": "C00473", "database": "COMPOUND", "url": "" }, { "id": "000003831417", "database": "ZINC", "url": "" }, { "id": "4053", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "8144182", "database": "PubChem Substance", "url": "" }, { "id": "17336", "database": "ChEBI", "url": "" }, { "id": "HMDB0000305", "database": "HMDB Metabolite", "url": "" }, { "id": "000003831417", "database": "ZINC", "url": "" }, { "id": "C00473", "database": "COMPOUND", "url": "" }, { "id": "4053", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "8144182", "database": "PubChem Substance", "url": "" }, { "id": "17336", "database": "ChEBI", "url": "" }, { "id": "C00473", "database": "COMPOUND", "url": "" }, { "id": "17336", "database": "ChEBI", "url": "" }, { "id": "HMDB0000305", "database": "HMDB Metabolite", "url": "" }, { "id": "8144182", "database": "PubChem Substance", "url": "" }, { "id": "000003831417", "database": "ZINC", "url": "" }, { "id": "4053", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00473", "database": "COMPOUND", "url": "" }, { "id": "17336", "database": "ChEBI", "url": "" }, { "id": "HMDB0000305", "database": "HMDB Metabolite", "url": "" }, { "id": "8144182", "database": "PubChem Substance", "url": "" }, { "id": "000003831417", "database": "ZINC", "url": "" }, { "id": "4053", "database": "Guide to Pharmacology - Ligands", "url": "" } ] }, { "participant_id": "R-ALL-5696412", "participant_name": "arachidyl ester [endoplasmic reticulum lumen]", "crossref": [ { "id": "10036", "database": "ChEBI", "url": "" }, { "id": "Wax-Esters", "database": "AraCyc", "url": "" }, { "id": "C01629", "database": "KEGG Gene", "url": "" }, { "id": "C01629", "database": "COMPOUND", "url": "" }, { "id": "10036", "database": "ChEBI", "url": "" }, { "id": "Wax-Esters", "database": "AraCyc", "url": "" }, { "id": "C01629", "database": "KEGG Gene", "url": "" }, { "id": "C01629", "database": "COMPOUND", "url": "" }, { "id": "10036", "database": "ChEBI", "url": "" }, { "id": "Wax-Esters", "database": "AraCyc", "url": "" }, { "id": "C01629", "database": "KEGG Gene", "url": "" }, { "id": "C01629", "database": "COMPOUND", "url": "" }, { "id": "10036", "database": "ChEBI", "url": "" }, { "id": "Wax-Esters", "database": "AraCyc", "url": "" }, { "id": "C01629", "database": "KEGG Gene", "url": "" }, { "id": "C01629", "database": "COMPOUND", "url": "" }, { "id": "Wax-Esters", "database": "AraCyc", "url": "" }, { "id": "C01629", "database": "COMPOUND", "url": "" }, { "id": "C01629", "database": "KEGG Gene", "url": "" }, { "id": "10036", "database": "ChEBI", "url": "" }, { "id": "10036", "database": "ChEBI", "url": "" }, { "id": "Wax-Esters", "database": "AraCyc", "url": "" }, { "id": "C01629", "database": "KEGG Gene", "url": "" }, { "id": "C01629", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-5696426", "participant_name": "ARACOH [endoplasmic reticulum lumen]", "crossref": [ { "id": "000032840992", "database": "ZINC", "url": "" }, { "id": "HMDB0011619", "database": "HMDB Metabolite", "url": "" }, { "id": "545111", "database": "ChEBI", "url": "" }, { "id": "75627", "database": "ChEBI", "url": "" }, { "id": "CPD-7869", "database": "AraCyc", "url": "" }, { "id": "12404", "database": "PubChem Compound", "url": "" }, { "id": "545111", "database": "ChEBI", "url": "" }, { "id": "000032840992", "database": "ZINC", "url": "" }, { "id": "HMDB0011619", "database": "HMDB Metabolite", "url": "" }, { "id": "12404", "database": "PubChem Compound", "url": "" }, { "id": "75627", "database": "ChEBI", "url": "" }, { "id": "CPD-7869", "database": "AraCyc", "url": "" }, { "id": "000032840992", "database": "ZINC", "url": "" }, { "id": "HMDB0011619", "database": "HMDB Metabolite", "url": "" }, { "id": "545111", "database": "ChEBI", "url": "" }, { "id": "75627", "database": "ChEBI", "url": "" }, { "id": "CPD-7869", "database": "AraCyc", "url": "" }, { "id": "12404", "database": "PubChem Compound", "url": "" }, { "id": "545111", "database": "ChEBI", "url": "" }, { "id": "000032840992", "database": "ZINC", "url": "" }, { "id": "HMDB0011619", "database": "HMDB Metabolite", "url": "" }, { "id": "12404", "database": "PubChem Compound", "url": "" }, { "id": "75627", "database": "ChEBI", "url": "" }, { "id": "CPD-7869", "database": "AraCyc", "url": "" }, { "id": "75627", "database": "ChEBI", "url": "" }, { "id": "545111", "database": "ChEBI", "url": "" }, { "id": "12404", "database": "PubChem Compound", "url": "" }, { "id": "000032840992", "database": "ZINC", "url": "" }, { "id": "CPD-7869", "database": "AraCyc", "url": "" }, { "id": "HMDB0011619", "database": "HMDB Metabolite", "url": "" }, { "id": "12404", "database": "PubChem Compound", "url": "" }, { "id": "CPD-7869", "database": "AraCyc", "url": "" }, { "id": "75627", "database": "ChEBI", "url": "" }, { "id": "HMDB0011619", "database": "HMDB Metabolite", "url": "" }, { "id": "000032840992", "database": "ZINC", "url": "" }, { "id": "545111", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-5696449", "participant_name": "MAG [endoplasmic reticulum membrane]", "crossref": [ { "id": "Monoacylglycerols", "database": "AraCyc", "url": "" }, { "id": "C01885", "database": "COMPOUND", "url": "" }, { "id": "C01885", "database": "KEGG Gene", "url": "" }, { "id": "17408", "database": "ChEBI", "url": "" }, { "id": "Monoacylglycerols", "database": "AraCyc", "url": "" }, { "id": "C01885", "database": "COMPOUND", "url": "" }, { "id": "C01885", "database": "KEGG Gene", "url": "" }, { "id": "17408", "database": "ChEBI", "url": "" }, { "id": "C01885", "database": "KEGG Gene", "url": "" }, { "id": "17408", "database": "ChEBI", "url": "" }, { "id": "Monoacylglycerols", "database": "AraCyc", "url": "" }, { "id": "C01885", "database": "COMPOUND", "url": "" }, { "id": "Monoacylglycerols", "database": "AraCyc", "url": "" }, { "id": "C01885", "database": "COMPOUND", "url": "" }, { "id": "17408", "database": "ChEBI", "url": "" }, { "id": "C01885", "database": "KEGG Gene", "url": "" }, { "id": "17408", "database": "ChEBI", "url": "" }, { "id": "Monoacylglycerols", "database": "AraCyc", "url": "" }, { "id": "C01885", "database": "KEGG Gene", "url": "" }, { "id": "C01885", "database": "COMPOUND", "url": "" }, { "id": "C01885", "database": "KEGG Gene", "url": "" }, { "id": "17408", "database": "ChEBI", "url": "" }, { "id": "C01885", "database": "COMPOUND", "url": "" }, { "id": "Monoacylglycerols", "database": "AraCyc", "url": "" } ] }, { "participant_id": "R-ALL-6782195", "participant_name": "Acyl-CoA [endoplasmic reticulum membrane]", "crossref": [ { "id": "17984", "database": "ChEBI", "url": "" }, { "id": "C00040", "database": "COMPOUND", "url": "" }, { "id": "17984", "database": "ChEBI", "url": "" }, { "id": "C00040", "database": "COMPOUND", "url": "" }, { "id": "C00040", "database": "COMPOUND", "url": "" }, { "id": "17984", "database": "ChEBI", "url": "" }, { "id": "C00040", "database": "COMPOUND", "url": "" }, { "id": "17984", "database": "ChEBI", "url": "" }, { "id": "17984", "database": "ChEBI", "url": "" }, { "id": "C00040", "database": "COMPOUND", "url": "" }, { "id": "17984", "database": "ChEBI", "url": "" }, { "id": "C00040", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-6800352", "participant_name": "2AG [cytosol]", "crossref": [ { "id": "C02112", "database": "COMPOUND", "url": "" }, { "id": "17389", "database": "ChEBI", "url": "" }, { "id": "C02112", "database": "COMPOUND", "url": "" }, { "id": "17389", "database": "ChEBI", "url": "" }, { "id": "C02112", "database": "COMPOUND", "url": "" }, { "id": "17389", "database": "ChEBI", "url": "" }, { "id": "C02112", "database": "COMPOUND", "url": "" }, { "id": "17389", "database": "ChEBI", "url": "" }, { "id": "17389", "database": "ChEBI", "url": "" }, { "id": "C02112", "database": "COMPOUND", "url": "" }, { "id": "C02112", "database": "COMPOUND", "url": "" }, { "id": "17389", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-8848499", "participant_name": "PALM-PALM [cytosol]", "crossref": [ { "id": "75584", "database": "ChEBI", "url": "" }, { "id": "HMDB0249838", "database": "HMDB Metabolite", "url": "" }, { "id": "000008437455", "database": "ZINC", "url": "" }, { "id": "C13821", "database": "COMPOUND", "url": "" }, { "id": "75584", "database": "ChEBI", "url": "" }, { "id": "HMDB0249838", "database": "HMDB Metabolite", "url": "" }, { "id": "000008437455", "database": "ZINC", "url": "" }, { "id": "C13821", "database": "COMPOUND", "url": "" }, { "id": "75584", "database": "ChEBI", "url": "" }, { "id": "HMDB0249838", "database": "HMDB Metabolite", "url": "" }, { "id": "000008437455", "database": "ZINC", "url": "" }, { "id": "C13821", "database": "COMPOUND", "url": "" }, { "id": "75584", "database": "ChEBI", "url": "" }, { "id": "HMDB0249838", "database": "HMDB Metabolite", "url": "" }, { "id": "000008437455", "database": "ZINC", "url": "" }, { "id": "C13821", "database": "COMPOUND", "url": "" }, { "id": "000008437455", "database": "ZINC", "url": "" }, { "id": "75584", "database": "ChEBI", "url": "" }, { "id": "C13821", "database": "COMPOUND", "url": "" }, { "id": "HMDB0249838", "database": "HMDB Metabolite", "url": "" }, { "id": "75584", "database": "ChEBI", "url": "" }, { "id": "HMDB0249838", "database": "HMDB Metabolite", "url": "" }, { "id": "000008437455", "database": "ZINC", "url": "" }, { "id": "C13821", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-8848577", "participant_name": "HXOL [cytosol]", "crossref": [ { "id": "HMDB0003424", "database": "HMDB Metabolite", "url": "" }, { "id": "16125", "database": "ChEBI", "url": "" }, { "id": "C00823", "database": "COMPOUND", "url": "" }, { "id": "000008214519", "database": "ZINC", "url": "" }, { "id": "16125", "database": "ChEBI", "url": "" }, { "id": "000008214519", "database": "ZINC", "url": "" }, { "id": "HMDB0003424", "database": "HMDB Metabolite", "url": "" }, { "id": "C00823", "database": "COMPOUND", "url": "" }, { "id": "16125", "database": "ChEBI", "url": "" }, { "id": "HMDB0003424", "database": "HMDB Metabolite", "url": "" }, { "id": "C00823", "database": "COMPOUND", "url": "" }, { "id": "000008214519", "database": "ZINC", "url": "" }, { "id": "16125", "database": "ChEBI", "url": "" }, { "id": "000008214519", "database": "ZINC", "url": "" }, { "id": "HMDB0003424", "database": "HMDB Metabolite", "url": "" }, { "id": "C00823", "database": "COMPOUND", "url": "" }, { "id": "16125", "database": "ChEBI", "url": "" }, { "id": "000008214519", "database": "ZINC", "url": "" }, { "id": "HMDB0003424", "database": "HMDB Metabolite", "url": "" }, { "id": "C00823", "database": "COMPOUND", "url": "" }, { "id": "16125", "database": "ChEBI", "url": "" }, { "id": "000008214519", "database": "ZINC", "url": "" }, { "id": "HMDB0003424", "database": "HMDB Metabolite", "url": "" }, { "id": "C00823", "database": "COMPOUND", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A1Z739", "gene_name": "Dmel\\CG1946", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "A1Z739", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1Z739" } ] } ] }, { "uniprot_ac": "Q7JYK2", "gene_name": "Dmel\\CG1941", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q7JYK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JYK2" } ] } ] }, { "uniprot_ac": "Q7K1C2", "gene_name": "Dgat2", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q7K1C2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K1C2" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }