{
    "uniprot_canonical_ac": "A0A8I6ARM0-1",
    "uniprot_ac": "A0A8I6ARM0",
    "uniprot_id": "A0A8I6ARM0_RAT",
    "mass": {
        "chemical_mass": 10153.0,
        "monoisotopic_mass": 10153.0
    },
    "refseq": {},
    "gene_names": [
        {
            "name": "ENSRNOG00000067798",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/A0A8I6ARM0",
            "id": "A0A8I6ARM0"
        }
    ],
    "protein_names": [
        {
            "name": "Ovule protein",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "A0A8I6ARM0"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Rattus norvegicus",
            "taxid": 10116,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A8I6ARM0",
                    "url": "https://www.uniprot.org/uniprot/A0A8I6ARM0"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "gene": [
        {
            "name": "ENSRNOG00000067798",
            "url": "https://www.uniprot.org/uniprot/A0A8I6ARM0",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "150341262",
            "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=150341262",
            "database": "RGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "A0A8I6ARM0",
            "url": "https://www.uniprot.org/uniprot/A0A8I6ARM0",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8I6ARM0-1",
            "url": "https://www.uniprot.org/uniprot/A0A8I6ARM0-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "FLKTKKIFLLRHSRPSRKVPYQKFHKKICSHENVRQTLKHFLISSEELQSKTCPHSFLGLTMSSYFICYVQSNLSSSLAKYGSQNTL",
        "length": 87,
        "header": "tr|A0A8I6ARM0-1|A0A8I6ARM0_RAT Isoform 1 of Ovule protein  OS=Rattus norvegicus OX=10116 GN=ENSRNOG00000067798 PE=4 SV=1 CANONICAL=A0A8I6ARM0-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A8I6ARM0-1",
            "url": "",
            "sequence": {
                "sequence": "FLKTKKIFLLRHSRPSRKVPYQKFHKKICSHENVRQTLKHFLISSEELQSKTCPHSFLGLTMSSYFICYVQSNLSSSLAKYGSQNTL",
                "length": 87,
                "header": "tr|A0A8I6ARM0-1|A0A8I6ARM0_RAT Isoform 1 of Ovule protein  OS=Rattus norvegicus OX=10116 GN=ENSRNOG00000067798 PE=4 SV=1 CANONICAL=A0A8I6ARM0-1"
            },
            "locus": {
                "chromosome": "3",
                "start_pos": 29895052,
                "end_pos": 29893704,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSRNOT00000093816.1",
                        "url": "https://www.ensembl.org/id/ENSRNOT00000093816.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSRNOP00000097688.1",
                        "url": "https://www.ensembl.org/id/ENSRNOP00000097688.1"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [],
    "pathway": [],
    "orthologs": [],
    "go_annotation": {},
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 73,
            "end_pos": 75,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        }
    ]
}