{ "uniprot_canonical_ac": "A0A8I6AE35-1", "uniprot_ac": "A0A8I6AE35", "uniprot_id": "A0A8I6AE35_RAT", "mass": { "chemical_mass": 38645.0, "monoisotopic_mass": 38645.0 }, "refseq": {}, "gene_names": [ { "name": "Ube2q2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A8I6AE35", "id": "A0A8I6AE35" } ], "protein_names": [ { "name": "Ubiquitin conjugating enzyme E2 Q2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A8I6AE35" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A8I6AE35", "url": "https://www.uniprot.org/uniprot/A0A8I6AE35" } ], "common_name": "Rat" } ], "gene": [ { "name": "Ube2q2", "url": "https://www.uniprot.org/uniprot/A0A8I6AE35", "locus": { "chromosome": "8", "start_pos": 55577212, "end_pos": 55519147, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000014529", "url": "https://www.ensembl.org/id/ENSRNOG00000014529" } ] } } ], "crossref": [ { "id": "ENSRNOG00000014529", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000014529", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR000608", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000608", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016135", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016135", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "FKXYVLG", "url": "https://omabrowser.org/oma/group/FKXYVLG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PF00179", "url": "http://pfam.xfam.org/family/PF00179", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_006226467", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006226467", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1307680", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1307680", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I6AE35", "url": "https://www.uniprot.org/uniprot/A0A8I6AE35", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AE35-1", "url": "https://www.uniprot.org/uniprot/A0A8I6AE35-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4A1G2", "url": "https://www.uniprot.org/uniprot/D4A1G2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4A1G2-1", "url": "https://www.uniprot.org/uniprot/D4A1G2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSVSGLKAELKFLASIFDKNHELFRIVSWKLDELHCQFLVPPPPPPGSSHSPPPPLTLHCNITESYPSSSPIWFVDSDDPNLTSVLERLEDTKNNSSNGTTEEVTSEEEEEEEMAEDIEDLDHYEMKEEEPINGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDVYRSQSYKAGIYSVELINDSLYDWHVKLHKVDSDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQIHEKNGWYTPPKEDG", "length": 342, "header": "tr|A0A8I6AE35-1|A0A8I6AE35_RAT Isoform 1 of Ubiquitin conjugating enzyme E2 Q2 OS=Rattus norvegicus OX=10116 GN=Ube2q2 PE=4 SV=1 CANONICAL=A0A8I6AE35-1" }, "isoforms": [ { "isoform_ac": "A0A8I6AE35-1", "url": "", "sequence": { "sequence": "MSVSGLKAELKFLASIFDKNHELFRIVSWKLDELHCQFLVPPPPPPGSSHSPPPPLTLHCNITESYPSSSPIWFVDSDDPNLTSVLERLEDTKNNSSNGTTEEVTSEEEEEEEMAEDIEDLDHYEMKEEEPINGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDVYRSQSYKAGIYSVELINDSLYDWHVKLHKVDSDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQIHEKNGWYTPPKEDG", "length": 342, "header": "tr|A0A8I6AE35-1|A0A8I6AE35_RAT Isoform 1 of Ubiquitin conjugating enzyme E2 Q2 OS=Rattus norvegicus OX=10116 GN=Ube2q2 PE=4 SV=1 CANONICAL=A0A8I6AE35-1" }, "locus": { "chromosome": "8", "start_pos": 55576805, "end_pos": 55519229, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000116015.1", "url": "https://www.ensembl.org/id/ENSRNOT00000116015.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000092651.1", "url": "https://www.ensembl.org/id/ENSRNOP00000092651.1" } ] } }, { "isoform_ac": "D4A1G2-1", "url": "", "sequence": { "sequence": "MSVSGLKAELKFLASIFDKNHELFRIVSWKLDELHCQFLVPPPPPPGSSHSPPPPLTLHCNITESYPSSSPIWFVDSDDPNLTSVLERLEDTKNNSSLRQQLKWLICDLCRLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEEEEEEEMAEDIEDLDHYEMKEEEPINGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDVYRSQSYKAGIYSVELINDSLYDWHVKLHKVDSDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQIHEKNGWYTPPKEDG", "length": 377, "header": "tr|D4A1G2-1|D4A1G2_RAT Computationally mapped isoform of Ubiquitin conjugating enzyme E2 Q2 OS=Rattus norvegicus OX=10116 GN=Ube2q2 PE=4 SV=4 CANONICAL=A0A8I6AE35-1" }, "locus": { "chromosome": "8", "start_pos": 55576805, "end_pos": 55519229, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000019539.8", "url": "https://www.ensembl.org/id/ENSRNOT00000019539.8" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000019539.8", "url": "https://www.ensembl.org/id/ENSRNOP00000019539.8" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "ubiquitin-protein transferase activity", "id": "GO:0004842", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004842", "evidence": [ { "database": "UniProtKB", "id": "A0A8I6AE35", "url": "https://www.uniprot.org/uniprot/A0A8I6AE35" } ], "pmid": "" }, { "name": "ubiquitin conjugating enzyme activity", "id": "GO:0061631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061631", "evidence": [ { "database": "UniProtKB", "id": "A0A8I6AE35", "url": "https://www.uniprot.org/uniprot/A0A8I6AE35" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "protein K48-linked ubiquitination", "id": "GO:0070936", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070936", "evidence": [ { "database": "UniProtKB", "id": "A0A8I6AE35", "url": "https://www.uniprot.org/uniprot/A0A8I6AE35" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A8I6AE35", "url": "https://www.uniprot.org/uniprot/A0A8I6AE35" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 200, "end_pos": 202, "annotation": "n_glycosylation_sequon" }, { "start_pos": 238, "end_pos": 240, "annotation": "n_glycosylation_sequon" }, { "start_pos": 294, "end_pos": 296, "annotation": "n_glycosylation_sequon" }, { "start_pos": 61, "end_pos": 63, "annotation": "n_glycosylation_sequon" }, { "start_pos": 81, "end_pos": 83, "annotation": "n_glycosylation_sequon" }, { "start_pos": 94, "end_pos": 96, "annotation": "n_glycosylation_sequon" }, { "start_pos": 95, "end_pos": 97, "annotation": "n_glycosylation_sequon" }, { "start_pos": 98, "end_pos": 100, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }