{ "uniprot_canonical_ac": "A0A0G2JUS5-1", "uniprot_ac": "A0A0G2JUS5", "uniprot_id": "A0A0G2JUS5_RAT", "mass": { "chemical_mass": 26956.0, "monoisotopic_mass": 26956.0 }, "refseq": { "ac": "NP_001100037", "name": "dolichyldiphosphatase 1 isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100037" }, "gene_names": [ { "name": "Dolpp1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2JUS5", "id": "A0A0G2JUS5" }, { "name": "Dolpp1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100037", "id": "NP_001100037" } ], "protein_names": [ { "name": "Dolichyldiphosphatase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A0G2JUS5" }, { "name": "3.6.1.43", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2JUS5" }, { "name": "dolichyl pyrophosphate phosphatase 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100037", "id": "NP_001100037" }, { "name": "dolichyldiphosphatase 1 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100037", "id": "NP_001100037" } ], "function": [ { "annotation": "Required for efficient N-glycosylation. Necessary for maintaining optimal levels of dolichol-linked oligosaccharides. Hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. Does not act on phosphatidate.", "evidence": [ { "database": "UniProtKB", "id": "D3Z917", "url": "https://www.uniprot.org/uniprot/D3Z917#function" }, { "database": "UniProtKB", "id": "ARBA00024907", "url": "https://www.uniprot.org/uniprot/ARBA00024907#function" }, { "database": "UniProtKB", "id": "RU367078", "url": "https://www.uniprot.org/uniprot/RU367078#function" }, { "database": "UniProtKB", "id": "A0A0G2JUS5", "url": "https://www.uniprot.org/uniprot/A0A0G2JUS5#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JUS5", "url": "https://www.uniprot.org/uniprot/A0A0G2JUS5" } ], "common_name": "Rat" } ], "gene": [ { "name": "Dolpp1", "url": "https://www.uniprot.org/uniprot/A0A0G2JUS5", "locus": { "chromosome": "3", "start_pos": 13674311, "end_pos": 13665823, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000017663", "url": "https://www.ensembl.org/id/ENSRNOG00000017663" } ] } } ], "crossref": [ { "id": "ENSRNOG00000017663", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000017663", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03382", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03382", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "296624", "url": "https://www.ncbi.nlm.nih.gov/gene/296624", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000326", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000326", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036938", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036938", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039667", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039667", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:296624", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:296624", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "VYATLIW", "url": "https://omabrowser.org/oma/group/VYATLIW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "989449at2759", "url": "http://www.orthodb.org/?query=989449at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11247", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11247", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11247:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11247:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01569", "url": "http://pfam.xfam.org/family/PF01569", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-446199", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-446199", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "1307447", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1307447", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "14385", "url": "https://www.rhea-db.org/rhea/14385", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0G2JUS5", "url": "https://www.uniprot.org/uniprot/A0A0G2JUS5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JUS5-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JUS5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z917", "url": "https://www.uniprot.org/uniprot/D3Z917", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z917-1", "url": "https://www.uniprot.org/uniprot/D3Z917-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPIFVIVGFVTLIIFKRELHTISFLGGLALNEGVNWLIKHVIQEPRPCPHTAVGTKYGMPSSHSQFMWFFSVYSFLFLYLRMHQTNNARFLDLLWRHVLSLGLLTAAFLVSYSRVYLLYHTWSQVFYGGVAGGLMAIAWFVITQEILTPLFPRIAAWPISEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ", "length": 236, "header": "tr|A0A0G2JUS5-1|A0A0G2JUS5_RAT Isoform 1 of Dolichyldiphosphatase OS=Rattus norvegicus OX=10116 GN=Dolpp1 PE=3 SV=2 CANONICAL=A0A0G2JUS5-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JUS5-1", "url": "", "sequence": { "sequence": "MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPIFVIVGFVTLIIFKRELHTISFLGGLALNEGVNWLIKHVIQEPRPCPHTAVGTKYGMPSSHSQFMWFFSVYSFLFLYLRMHQTNNARFLDLLWRHVLSLGLLTAAFLVSYSRVYLLYHTWSQVFYGGVAGGLMAIAWFVITQEILTPLFPRIAAWPISEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ", "length": 236, "header": "tr|A0A0G2JUS5-1|A0A0G2JUS5_RAT Isoform 1 of Dolichyldiphosphatase OS=Rattus norvegicus OX=10116 GN=Dolpp1 PE=3 SV=2 CANONICAL=A0A0G2JUS5-1" }, "locus": { "chromosome": "3", "start_pos": 13672945, "end_pos": 13666021, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000086789.2", "url": "https://www.ensembl.org/id/ENSRNOT00000086789.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000069211.2", "url": "https://www.ensembl.org/id/ENSRNOP00000069211.2" } ] } }, { "isoform_ac": "D3Z917-1", "url": "", "sequence": { "sequence": "MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPIFVIVGFVTLIIFKRELHTISFLGGLALNEGVNWLIKHVIQEPRPCGGPHTAVGTKYGMPSSHSQFMWFFSVYSFLFLYLRMHQTNNARFLDLLWRHVLSLGLLTAAFLVSYSRPISEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ", "length": 195, "header": "tr|D3Z917-1|D3Z917_RAT Computationally mapped isoform of Dolichyldiphosphatase OS=Rattus norvegicus OX=10116 GN=Dolpp1 PE=3 SV=1 CANONICAL=A0A0G2JUS5-1" }, "locus": { "chromosome": "3", "start_pos": 13672945, "end_pos": 13666021, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000064557.2", "url": "https://www.ensembl.org/id/ENSRNOT00000064557.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000058902.1", "url": "https://www.ensembl.org/id/ENSRNOP00000058902.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "rno:296624", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:296624", "resource": "KEGG Pathway" }, { "id": "R-RNO-446199", "name": "Synthesis of Dolichyl-phosphate", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-446199", "resource": "Reactome", "description": "Synthesis of Dolichyl-phosphate" } ], "orthologs": [ { "uniprot_canonical_ac": "Q86YN1-1", "protein_name": "Dolichyldiphosphatase 1", "gene_name": "DOLPP1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLIIFKRELHTISFLGGLALNEGVNWLIKNVIQEPRPCGGPHTAVGTKYGMPSSHSQFMWFFSVYSFLFLYLRMHQTNNARFLDLLWRHVLSLGLLAVAFLVSYSRVYLLYHTWSQVLYGGIAGGLMAIAWFIFTQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ", "length": 238 }, "evidence": [ { "id": "45233249", "url": "http://www.informatics.jax.org/homology/45233249", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9JMF7-1", "protein_name": "Dolichyldiphosphatase 1", "gene_name": "Dolpp1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPIFVVVGFLTLIIFKRELHTISFLGGLALNQGVNWLIKHVIQEPRPCGGPHTAVGTKYGMPSSHSQFMWFFSVYSFLFLYLRMHQTNNARFLDLLWRHVLSLGLLTAAFLVSYSRVYLLYHTWSQVFYGGVAGSLMAVAWFIITQEILTPLFPRIAAWPISEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ", "length": 238 }, "evidence": [ { "id": "45233249", "url": "http://www.informatics.jax.org/homology/45233249", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "lipid biosynthetic process", "id": "GO:0008610", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008610", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JUS5", "url": "https://www.uniprot.org/uniprot/A0A0G2JUS5" } ], "pmid": "" }, { "name": "protein N-linked glycosylation", "id": "GO:0006487", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006487", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JUS5", "url": "https://www.uniprot.org/uniprot/A0A0G2JUS5" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JUS5", "url": "https://www.uniprot.org/uniprot/A0A0G2JUS5" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JUS5", "url": "https://www.uniprot.org/uniprot/A0A0G2JUS5" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "dolichyldiphosphatase activity", "id": "GO:0047874", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047874", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JUS5", "url": "https://www.uniprot.org/uniprot/A0A0G2JUS5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "14385", "name": "", "equation": "a dolichyl diphosphate + H2O = a dolichyl phosphate + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2JUS5-1", "Q86YN1-1", "Q9JMF7-1", "P53223-1", "Q86IX2-1" ], "evidence": [ { "id": "14385", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/14385" } ] }, { "id": "R-RNO-446200", "name": "DOLPP1 dephosphorylates DOLDP to DOLP", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-449744" ], "output_participant_list": [], "enzyme_list": [ "A0A0G2JUS5-1" ], "evidence": [ { "id": "R-RNO-446200", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-446200" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-449744", "participant_name": "DOLDP [integral component of cytoplasmic side of endoplasmic reticulum membrane]", "crossref": [ { "id": "C00621", "database": "COMPOUND", "url": "" }, { "id": "HMDB0001513", "database": "HMDB Metabolite", "url": "" }, { "id": "15750", "database": "ChEBI", "url": "" }, { "id": "000030320809", "database": "ZINC", "url": "" }, { "id": "000030320812", "database": "ZINC", "url": "" }, { "id": "000030320812", "database": "ZINC", "url": "" }, { "id": "C00621", "database": "COMPOUND", "url": "" }, { "id": "15750", "database": "ChEBI", "url": "" }, { "id": "000030320809", "database": "ZINC", "url": "" }, { "id": "HMDB0001513", "database": "HMDB Metabolite", "url": "" }, { "id": "000030320809", "database": "ZINC", "url": "" }, { "id": "000030320812", "database": "ZINC", "url": "" }, { "id": "HMDB0001513", "database": "HMDB Metabolite", "url": "" }, { "id": "15750", "database": "ChEBI", "url": "" }, { "id": "C00621", "database": "COMPOUND", "url": "" }, { "id": "C00621", "database": "COMPOUND", "url": "" }, { "id": "15750", "database": "ChEBI", "url": "" }, { "id": "HMDB0001513", "database": "HMDB Metabolite", "url": "" }, { "id": "000030320812", "database": "ZINC", "url": "" }, { "id": "000030320809", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JUS5", "gene_name": "Dolpp1", "activity": [ { "ec_number": "3.6.1.43", "activity": "a dolichyl diphosphate + H2O = a dolichyl phosphate + H(+) + phosphate.", "evidence": [ { "id": "A0A0G2JUS5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JUS5" } ] }, { "ec_number": "3.6.1.43", "activity": "", "evidence": [ { "id": "A0A0G2JUS5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JUS5" } ] } ] }, { "uniprot_ac": "P53223", "gene_name": "CAX4", "activity": [ { "ec_number": "3.6.1.43", "activity": "a dolichyl diphosphate + H2O = a dolichyl phosphate + H(+) + phosphate.", "evidence": [ { "id": "P53223", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53223" } ] }, { "ec_number": "3.6.1.43", "activity": "", "evidence": [ { "id": "P53223", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53223" } ] } ] }, { "uniprot_ac": "Q86IX2", "gene_name": "dolpp1", "activity": [ { "ec_number": "3.6.1.43", "activity": "a dolichyl diphosphate + H2O = a dolichyl phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q86IX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86IX2" } ] }, { "ec_number": "3.6.1.43", "activity": "", "evidence": [ { "id": "Q86IX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86IX2" } ] } ] }, { "uniprot_ac": "Q86YN1", "gene_name": "DOLPP1", "activity": [ { "ec_number": "3.6.1.43", "activity": "a dolichyl diphosphate + H2O = a dolichyl phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q86YN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86YN1" } ] }, { "ec_number": "3.6.1.43", "activity": "", "evidence": [ { "id": "Q86YN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86YN1" } ] } ] }, { "uniprot_ac": "Q9JMF7", "gene_name": "Dolpp1", "activity": [ { "ec_number": "3.6.1.43", "activity": "a dolichyl diphosphate + H2O = a dolichyl phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q9JMF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JMF7" } ] }, { "ec_number": "3.6.1.43", "activity": "", "evidence": [ { "id": "Q9JMF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JMF7" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }