{
    "uniprot_canonical_ac": "A6KSS8-1",
    "uniprot_ac": "A6KSS8",
    "uniprot_id": "A6KSS8_RAT",
    "mass": {
        "chemical_mass": 81063.0,
        "monoisotopic_mass": 81063.0
    },
    "refseq": {
        "ac": "NP_001004203",
        "name": "DNA replication licensing factor MCM7",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004203"
    },
    "gene_names": [
        {
            "name": "Mcm7",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/A6KSS8",
            "id": "A6KSS8"
        },
        {
            "name": "MCM7",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/A6KSS8",
            "id": "A6KSS8"
        },
        {
            "name": "Mcm7",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004203",
            "id": "NP_001004203"
        }
    ],
    "protein_names": [
        {
            "name": "DNA replication licensing factor MCM7",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprotkb/A6KSS8/entry#names_and_taxonomy",
            "id": "A6KSS8"
        },
        {
            "name": "3.6.4.12",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprotkb/A6KSS8/entry#names_and_taxonomy",
            "id": "A6KSS8"
        },
        {
            "name": "DNA replication licensing factor MCM7",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004203",
            "id": "NP_001004203"
        },
        {
            "name": "minichromosome maintenance deficient 7; minichromosome maintenance protein 7",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004203",
            "id": "NP_001004203"
        }
    ],
    "function": [
        {
            "annotation": "Acts as component of the MCM2-7 complex (MCM complex) which is the replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "F7F0X7",
                    "url": "https://www.uniprot.org/uniprot/F7F0X7#function"
                },
                {
                    "database": "UniProtKB",
                    "id": "RU365012",
                    "url": "https://www.uniprot.org/uniprot/RU365012#function"
                },
                {
                    "database": "UniProtKB",
                    "id": "A0A8I5ZTF3",
                    "url": "https://www.uniprot.org/uniprot/A0A8I5ZTF3#function"
                },
                {
                    "database": "UniProtKB",
                    "id": "A6KSS8",
                    "url": "https://www.uniprot.org/uniprot/A6KSS8#function"
                }
            ]
        },
        {
            "annotation": "MCM7 expression and distribution change in injured spinal cord tissue.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001004203",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004203"
                },
                {
                    "database": "PubMed",
                    "id": "23526403",
                    "url": "https://glygen.org/publication/PubMed/23526403"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:3587",
            "recommended_name": {
                "id": "DOID:3587",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:3587",
                "name": "pancreatic ductal carcinoma",
                "description": "A pancreatic carcinoma located_in the pancreatic duct."
            },
            "synonyms": [
                {
                    "id": "DOID:3587",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:3587",
                    "name": "malignant neoplasm of duct of Wirsung",
                    "description": ""
                },
                {
                    "id": "DOID:3587",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:3587",
                    "name": "pancreatic duct cancer",
                    "description": ""
                }
            ],
            "evidence": [
                {
                    "id": "3587",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:3587"
                }
            ]
        },
        {
            "disease_id": "DOID:684",
            "recommended_name": {
                "id": "DOID:684",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:684",
                "name": "hepatocellular carcinoma",
                "description": "A liver carcinoma that has_material_basis_in undifferentiated hepatocytes and located_in the liver."
            },
            "synonyms": [
                {
                    "id": "DOID:684",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:684",
                    "name": "Hepatoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatocellular carcinoma",
                    "description": "A malignant tumor that arises from hepatocytes. Hepatocellular carcinoma is relatively rare in the United States but very common in all African countries south of the Sahara and in Southeast Asia. Most cases are seen in patients over the age of 50 years, but this tumor can also occur in younger individuals and even in children. Hepatocellular carcinoma is more common in males than females and is associated with hepatitis B, hepatitis C, chronic alcohol abuse and cirrhosis. Serum elevation of alpha-fetoprotein occurs in a large percentage of patients with hepatocellular carcinoma. Grossly, hepatocellular carcinoma may present as a single mass, as multiple nodules, or as diffuse liver involvement. Microscopically, there is a wide range of differentiation from tumor to tumor (well differentiated to poorly differentiated tumors). Hepatocellular carcinomas quickly metastasize to regional lymph nodes and lung. The overall median survival of untreated liver cell carcinoma is about 4 months. The most effective treatment of hepatocellular carcinoma is complete resection of the tumor. Lately, an increasing number of tumors have been treated with liver transplantation."
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "HCC",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "cancer, hepatocellular",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "carcinoma of liver",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "carcinoma of liver cells",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "carcinoma of the liver cells",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "carcinoma, hepatocellular, malignant",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatoblastoma, somatic",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatocellular adenocarcinoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatocellular cancer",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatocellular cancer, somatic",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatocellular carcinoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatocellular carcinoma, childhood type, somatic",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatocellular carcinoma, somatic",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "liver carcinoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "liver cell cancer (hepatocellular carcinoma)",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "liver cell carcinoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "primary carcinoma of liver cells",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "primary carcinoma of the liver cells",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "adult hepatoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "adult primary hepatocellular carcinoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatoblastoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatoblastoma caused by somatic mutation",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "liver and intrahepatic bile duct carcinoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "liver cancer",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatocellular carcinoma",
                    "description": "A malignant tumor that arises from hepatocytes. Hepatocellular carcinoma is relatively rare in the United States but very common in all African countries south of the Sahara and in Southeast Asia. Most cases are seen in patients over the age of 50 years, but this tumor can also occur in younger individuals and even in children. Hepatocellular carcinoma is more common in males than females and is associated with hepatitis B, hepatitis C, chronic alcohol abuse and cirrhosis. Serum elevation of alpha-fetoprotein occurs in a large percentage of patients with hepatocellular carcinoma. Grossly, hepatocellular carcinoma may present as a single mass, as multiple nodules, or as diffuse liver involvement. Microscopically, there is a wide range of differentiation from tumor to tumor (well differentiated to poorly differentiated tumors). Hepatocellular carcinomas quickly metastasize to regional lymph nodes and lung. The overall median survival of untreated liver cell carcinoma is about 4 months. The most effective treatment of hepatocellular carcinoma is complete resection of the tumor. Lately, an increasing number of tumors have been treated with liver transplantation."
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "HCC",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "cancer, hepatocellular",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "carcinoma of liver",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "carcinoma of liver cells",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "carcinoma of the liver cells",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "carcinoma, hepatocellular, malignant",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatoblastoma, somatic",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatocellular adenocarcinoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatocellular cancer",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatocellular cancer, somatic",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatocellular carcinoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatocellular carcinoma, childhood type, somatic",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatocellular carcinoma, somatic",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "liver carcinoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "liver cell cancer (hepatocellular carcinoma)",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "liver cell carcinoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "primary carcinoma of liver cells",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "primary carcinoma of the liver cells",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "adult hepatoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "adult primary hepatocellular carcinoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatoblastoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "hepatoblastoma caused by somatic mutation",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "liver and intrahepatic bile duct carcinoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0007256",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0007256",
                    "name": "liver cancer",
                    "description": ""
                },
                {
                    "id": "MIM:114550",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/114550",
                    "name": "Hepatocellular carcinoma",
                    "description": "Hepatocellular carcinoma"
                }
            ],
            "evidence": [
                {
                    "id": "684",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:684"
                }
            ]
        },
        {
            "disease_id": "DOID:7998",
            "recommended_name": {
                "id": "DOID:7998",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:7998",
                "name": "hyperthyroidism",
                "description": "A thyroid gland disease that involves an over production of thyroid hormone."
            },
            "synonyms": [
                {
                    "id": "DOID:7998",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:7998",
                    "name": "overactive thyroid",
                    "description": ""
                }
            ],
            "evidence": [
                {
                    "id": "7998",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:7998"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Rattus norvegicus",
            "taxid": 10116,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A6KSS8",
                    "url": "https://www.uniprot.org/uniprot/A6KSS8"
                }
            ],
            "common_name": "Rat",
            "glygen_name": "Rat",
            "reference_species": "Rattus norvegicus [10116]"
        }
    ],
    "gene": [
        {
            "name": "Mcm7",
            "url": "https://www.uniprot.org/uniprot/A6KSS8",
            "locus": {
                "chromosome": "12",
                "start_pos": 17042212,
                "end_pos": 17050063,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSRNOG00000001349",
                        "url": "https://www.ensembl.org/id/ENSRNOG00000001349"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSRNOG00000001349",
            "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000001349",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "cd17758",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd17758",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "288532",
            "url": "https://www.ncbi.nlm.nih.gov/gene/288532",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR001208",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001208",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR003593",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR003593",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR008050",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR008050",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR012340",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR012340",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR018525",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR018525",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR027417",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR027925",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR027925",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR031327",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR031327",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR033762",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR033762",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR041562",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR041562",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "rno:288532",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:288532",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "AQHVTYV",
            "url": "https://omabrowser.org/oma/group/AQHVTYV/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5476523at2759",
            "url": "http://www.orthodb.org/?query=5476523at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11630",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11630",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11630:SF26",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11630:SF26",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00493",
            "url": "http://pfam.xfam.org/family/PF00493",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF14551",
            "url": "http://pfam.xfam.org/family/PF14551",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF17207",
            "url": "http://pfam.xfam.org/family/PF17207",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF17855",
            "url": "http://pfam.xfam.org/family/PF17855",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_001004203",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004203",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "1303018",
            "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1303018",
            "database": "RGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "13065",
            "url": "https://www.rhea-db.org/rhea/13065",
            "database": "Rhea",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "A0A8I5ZTF3",
            "url": "https://www.uniprot.org/uniprot/A0A8I5ZTF3",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8I5ZTF3-1",
            "url": "https://www.uniprot.org/uniprot/A0A8I5ZTF3-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A6KSS8",
            "url": "https://www.uniprot.org/uniprot/A6KSS8",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A6KSS8-1",
            "url": "https://www.uniprot.org/uniprot/A6KSS8-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "F7F0X7",
            "url": "https://www.uniprot.org/uniprot/F7F0X7",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "F7F0X7-1",
            "url": "https://www.uniprot.org/uniprot/F7F0X7-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MALKDYAIEKEKVKKFLQEFYYDDELGKKQFKYGTQLVHLAHREQVALYVDLDDVAEDDPELVDSICENAKRYSRLFADVVQELLPEYKEKEVVNKDVLDVYIEHRLMMEQRSRDPGAVRNPQNQYPSELMRRFELYFQGPSSSKPRVIREVRADSVGKLLTVRGIVTRVSEVKPRMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSKFIKFQEMKIQEHSDQVPVGNIPRSITVVLEGENTRIAQPGDHVSVTGIFLPVLRTGFQQMAQGLLSETYLEAHRVVKMTKSEDDVSGAGELSAEELKQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPQGMKIRGNIHICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPAQFEPLDMKLMRRYIAMCRERQPTVPDSLADYITAAYVEMRREARASKDATYTSARTLLAILRLSTALARLRMVDIVEKEDVNEAIRLMEMSKDSLLGEKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCISRGFTPAQFQAALDEYEELNVWQVNTSRTRITFV",
        "length": 719,
        "header": "tr|A6KSS8-1|A6KSS8_RAT Isoform 1 of DNA replication licensing factor MCM7  OS=Rattus norvegicus OX=10116 GN=Mcm7 PE=1 SV=1 CANONICAL=A6KSS8-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A8I5ZTF3-1",
            "url": "https://www.uniprot.org/uniprotkb/A6KSS8/entry#A0A8I5ZTF3-1",
            "sequence": {
                "sequence": "MALKDYAIEKEKVKKFLQEFYYDDELGKKQFKYGTQLVHLAHREQVALYVDLDDVAEDDPELVDSICENAKRYSRLFADVVQELLPEYKEKEVVNKDVLDVYIEHRLMMEQRSRDPGAVRNPQNQYPSELMRRFELYFQGPSSSKPRVIREVRADSVGKLLTVRGIVTRVSEVKPRMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSKFIKFQEMKIQEHSDQVPVGNIPRSITVVLEGENTRIAQPGDHVSVTGIFLPVLRTGFQQMAQGLLSETYLEAHRVVKMTKSEDDVSGAGELSAEELKQIADVIFATVRELVSGGRSVRFSEAEQRCISRGFTPAQFQAALDEYEELNVWQVNTSRTRITFV",
                "length": 389,
                "header": "tr|A0A8I5ZTF3-1|A0A8I5ZTF3_RAT Computationally mapped isoform of DNA replication licensing factor MCM7  OS=Rattus norvegicus OX=10116 GN=Mcm7 PE=1 SV=1 CANONICAL=A6KSS8-1"
            },
            "locus": {
                "chromosome": "12",
                "start_pos": 17049411,
                "end_pos": 17042328,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSRNOT00000118343.1",
                        "url": "https://www.ensembl.org/id/ENSRNOT00000118343.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSRNOP00000081743.1",
                        "url": "https://www.ensembl.org/id/ENSRNOP00000081743.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A6KSS8-1",
            "url": "https://www.uniprot.org/uniprotkb/A6KSS8/entry#A6KSS8-1",
            "sequence": {
                "sequence": "MALKDYAIEKEKVKKFLQEFYYDDELGKKQFKYGTQLVHLAHREQVALYVDLDDVAEDDPELVDSICENAKRYSRLFADVVQELLPEYKEKEVVNKDVLDVYIEHRLMMEQRSRDPGAVRNPQNQYPSELMRRFELYFQGPSSSKPRVIREVRADSVGKLLTVRGIVTRVSEVKPRMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSKFIKFQEMKIQEHSDQVPVGNIPRSITVVLEGENTRIAQPGDHVSVTGIFLPVLRTGFQQMAQGLLSETYLEAHRVVKMTKSEDDVSGAGELSAEELKQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPQGMKIRGNIHICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPAQFEPLDMKLMRRYIAMCRERQPTVPDSLADYITAAYVEMRREARASKDATYTSARTLLAILRLSTALARLRMVDIVEKEDVNEAIRLMEMSKDSLLGEKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCISRGFTPAQFQAALDEYEELNVWQVNTSRTRITFV",
                "length": 719,
                "header": "tr|A6KSS8-1|A6KSS8_RAT Isoform 1 of DNA replication licensing factor MCM7  OS=Rattus norvegicus OX=10116 GN=Mcm7 PE=1 SV=1 CANONICAL=A6KSS8-1"
            },
            "locus": {
                "chromosome": "12",
                "start_pos": 17049411,
                "end_pos": 17042328,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSRNOT00000105826.1",
                        "url": "https://www.ensembl.org/id/ENSRNOT00000105826.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSRNOP00000076814.1",
                        "url": "https://www.ensembl.org/id/ENSRNOP00000076814.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "F7F0X7-1",
            "url": "https://www.uniprot.org/uniprotkb/A6KSS8/entry#F7F0X7-1",
            "sequence": {
                "sequence": "MIFYFIFVEKVKKFLQEFYYDDELGKKQFKYGTQLVHLAHREQVALYVDLDDVAEDDPELVDSICENAKRYSRLFADVVQELLPEYKEKEVVNKDVLDVYIEHRLMMEQRSRDPGAVRNPQNQYPSELMRRFELYFQGPSSSKPRVIREVRADSVGKLLTVRGIVTRVSEVKPRMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSKFIKFQEMKIQEHSDQVPVGNIPRSITVVLEGENTRIAQPGDHVSVTGIFLPVLRTGFQQMAQGLLSETYLEAHRVVKMTKSEDDVSGAGELSAEELKQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPQGMKIRGNIHICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPAQFEPLDMKLMRRYIAMCRERQPTVPDSLADYITAAYVEMRREARASKDATYTSARTLLAILRLSTALARLRMVDIVEKEDVNEAIRLMEMSKDSLLGEKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCISRGFTPAQFQAALDEYEELNVWQVNTSRTRITFV",
                "length": 717,
                "header": "tr|F7F0X7-1|A6KSS8_RAT Computationally mapped isoform of DNA replication licensing factor MCM7  OS=Rattus norvegicus OX=10116 GN=Mcm7 PE=1 SV=1 CANONICAL=A6KSS8-1"
            },
            "locus": {
                "chromosome": "12",
                "start_pos": 17048939,
                "end_pos": 17042328,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSRNOT00000001825.6",
                        "url": "https://www.ensembl.org/id/ENSRNOT00000001825.6"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSRNOP00000001825.5",
                        "url": "https://www.ensembl.org/id/ENSRNOP00000001825.5"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "enzyme"
    ],
    "publication": [
        {
            "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.",
            "journal": "Nat. Commun.",
            "date": "2012",
            "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "F7F0X7",
                    "url": "https://www.uniprot.org/uniprot/F7F0X7"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22673903",
                    "url": "https://glygen.org/publication/PubMed/22673903"
                }
            ]
        },
        {
            "title": "MCM7 expression is altered in rat after spinal cord injury.",
            "journal": "Journal of molecular neuroscience : MN",
            "date": "2013",
            "authors": "Chen J, Cui Z, Li W, Shen A, Xu G, Bao G, Sun Y, Wang L, Fan J, Zhang J, Yang L, Cui Z",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001004203",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004203"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23526403",
                    "url": "https://glygen.org/publication/PubMed/23526403"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "rno:288532",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:288532",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "A0A286ZJM4-1",
            "protein_name": "DNA replication licensing factor MCM7",
            "gene_name": "MCM7",
            "tax_id": 9823,
            "organism": "Sus scrofa",
            "sequence": {
                "sequence": "MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVAMYIDLDDVTEDDPELVDSICENTKRYARLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGAARSPQNQYPPELMRRFELYFQGPSSSKPRVIREVRADSVGKLVTVRGIVTRVSEVKPRMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSKFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEAHRIVKMSKSEDDESGAGELSREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPAQFEPLDMKLMRRYIAMCREKQPTVPESLADYITAAYVEMRREAWASKDATYTSARTLLAILRLSTALARLRMVDTVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSEGRSVRFSEAEQRCISRGFTPAQFQAALDEYEELNVWQVNTARTRITFV",
                "length": 719
            },
            "evidence": [
                {
                    "id": "A6KSS8",
                    "url": "https://omabrowser.org/oma/group/A6KSS8/",
                    "database": "OMA"
                }
            ],
            "glygen_name": "Pig",
            "common_name": "Pig"
        },
        {
            "uniprot_canonical_ac": "P33993-1",
            "protein_name": "DNA replication licensing factor MCM7",
            "gene_name": "MCM7",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVRSPQNQYPAELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEAHRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPSQFEPLDMKLMRRYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATYTSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV",
                "length": 719
            },
            "evidence": [
                {
                    "id": "46358277",
                    "url": "http://www.informatics.jax.org/homology/46358277",
                    "database": "MGI"
                },
                {
                    "id": "A6KSS8",
                    "url": "https://omabrowser.org/oma/group/A6KSS8/",
                    "database": "OMA"
                }
            ],
            "glygen_name": "Human",
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "P38132-1",
            "protein_name": "DNA replication licensing factor MCM7",
            "gene_name": "MCM7",
            "tax_id": 559292,
            "organism": "Saccharomyces cerevisiae S288C",
            "sequence": {
                "sequence": "MSAALPSIQLPVDYNNLFNEITDFLVTFKQDTLSSDATRNENEDENLDAENIEQHLLEKGPKYMAMLQKVANRELNSVIIDLDDILQYQNEKFLQGTQADDLVSAIQQNANHFTELFCRAIDNNMPLPTKEIDYKDDVLDVILNQRRLRNERMLSDRTNEIRSENLMDTTMDPPSSMNDALREVVEDETELFPPNLTRRYFLYFKPLSQNCARRYRKKAISSKPLSVRQIKGDFLGQLITVRGIITRVSDVKPAVEVIAYTCDQCGYEVFQEVNSRTFTPLSECTSEECSQNQTKGQLFMSTRASKFSAFQECKIQELSQQVPVGHIPRSLNIHVNGTLVRSLSPGDIVDVTGIFLPAPYTGFKALKAGLLTETYLEAQFVRQHKKKFASFSLTSDVEERVMELITSGDVYNRLAKSIAPEIYGNLDVKKALLLLLVGGVDKRVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRGVYTTGKGSSGVGLTAAVMKDPVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNARTSILAAANPLYGRYNPRLSPLDNINLPAALLSRFDILFLMLDIPSRDDDEKLAEHVTYVHMHNKQPDLDFTPVEPSKMREYIAYAKTKRPVMSEAVNDYVVQAYIRLRQDSKREMDSKFSFGQATPRTLLGIIRLSQALAKLRLADMVDIDDVEEALRLVRVSKESLYQETNKSKEDESPTTKIFTIIKKMLQETGKNTLSYENIVKTVRLRGFTMLQLSNCIQEYSYLNVWHLINEGNTLKFVDDGTMDTDQEDSLVSTPKLAPQTTASANVSAQDSDIDLQDA",
                "length": 845
            },
            "evidence": [
                {
                    "id": "A6KSS8",
                    "url": "https://omabrowser.org/oma/group/A6KSS8/",
                    "database": "OMA"
                }
            ],
            "glygen_name": "Yeast",
            "common_name": "Baker's yeast"
        },
        {
            "uniprot_canonical_ac": "Q54RU0-1",
            "protein_name": "DNA replication licensing factor MCM7",
            "gene_name": "MCM7",
            "tax_id": 44689,
            "organism": "Dictyostelium discoideum",
            "sequence": {
                "sequence": "MENKPYTPFNNNNNFKKKNNNNNNNKKTFFKDNDGNSNNITLSTGLDYLSEKEKCKDFLNFFKCTDNGNIGGFEKYVEMMKEITQRKRKNFDIELDDVYNFNRDLVFVESIENQTSTYLRLFTYALDELIPPPDLSSTRSAMGFNNDDGFDKNKEDQKFYQNSDMVLDLLASQRIQRKKFLQEQNRLDLDSNEFDFPQEIIRRFELHFIPRKGKSIIPIRLIRSELIGRLVTFSGVVTRVTDVKPLVVISLYTCDICGAEIFQEITSREFMPLFQCKSKQCTEGGKQAGNLTLQTRGSKFVKFQEIKVQEIANQVPIGHTPRSIKVYVRGELTRMASPGDIVTMSGIFLPTPYTGHKAIKAGLLADTYIEAMQILQHKKTYEQLDLTEEMLKKIQDESQNENIYDRLAMSLAPEIYGHLDVKKALLLMMVGGESKHMKDGMNIRGDINICLMGDPGIAKSQLLKHIAKVAPRGIYTSGKGSSGVGLTAAVIRDTMTGEFVLEGGSLVLADMGICCIDEFDKMEDSDRTAIHEVMEQQTISIAKAGITTTLNARTSILAAANPAYGRYNFDRSPDENFRLPHSLLSRFDLLFLMVDKADMDNDRLLSEHVTYVHMHSKPPQLSFEPFDSEFIRAYVSQARKIIPPVPKDLTNYIVDSYITLRKQDSETKTPFTYTTARTLLGVLRLSQAFARLKFSQQVSQEDVEESMRLMFVSKQSIRFKNEKKTPQNPSSIIYTLIKDHCALNRVKKVSIFDIQQKVFSSGFTQQHLDDCLNLYKSVLNSNSNFISLI",
                "length": 789
            },
            "evidence": [
                {
                    "id": "A6KSS8",
                    "url": "https://omabrowser.org/oma/group/A6KSS8/",
                    "database": "OMA"
                }
            ],
            "glygen_name": "Cellular slime mold",
            "common_name": "Social amoeba"
        },
        {
            "uniprot_canonical_ac": "Q61881-1",
            "protein_name": "DNA replication licensing factor MCM7",
            "gene_name": "Mcm7",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MALKDYAIEKEKVKKFLQEFYYENELGKKQFKYGTQLVHLAHREQVALYVDLDDIAEDDPELVDSICENAKRYSRLFGDVVQELLPEYKEKEVVNKDVLDVYIEHRLMMEQRSRDPGAVRNPQNQYPSELMRRFELYFRGPSSSKPRVIREVRADSVGKLLTVRGIVTRVSEVKPRMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSKFVKFQEMKIQEHSDQVPVGNIPRSITVVLEGENTRIAQPGDHVSVTGIFLPVLRTGFQQMAQGLLSETYLEAHWIVKMTKSDDDVSGAGELSSEELKQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPQGMKIRGNIHICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNVQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPAQFEPLDMKLMRRYIAMCHERQPTVPESLADYITAAYVEMRREARASKDATYTSARTLLAILRLSTALARLRMVDIVEKEDVNEAIRLMEMSKDSLLGEKGQTARTQRPADVIFATIRELVSRGRSVHFSEAEQRCISRGFTPAQFQAALDEYEELNVWQVNTSRTRITFV",
                "length": 719
            },
            "evidence": [
                {
                    "id": "46358277",
                    "url": "http://www.informatics.jax.org/homology/46358277",
                    "database": "MGI"
                },
                {
                    "id": "A6KSS8",
                    "url": "https://omabrowser.org/oma/group/A6KSS8/",
                    "database": "OMA"
                }
            ],
            "glygen_name": "Mouse",
            "common_name": "Mouse"
        },
        {
            "uniprot_canonical_ac": "Q9XYU0-1",
            "protein_name": "DNA replication licensing factor Mcm7",
            "gene_name": "Mcm7",
            "tax_id": 7227,
            "organism": "Drosophila melanogaster",
            "sequence": {
                "sequence": "MARRDYAQDRESIKTFLSEFCKCDDDGKKEFVYGSQLVKLAHREQVLITIDLDDLAEFNESLAEAVVDNCRRYTSIFSDVIAELLPSYKQQEVHAKDALDVYIEHRLMMESRTRNPMEQRDERNSFPSELMKRFEVGFKPLSTEKAHSIREVKAQHIGKLVTVRGIVTRCTEVKPMMVVATYTCDRCGSETYQPVNSLSFTPVHDCPSDDCRVNKAGGRLYLQTRGSKFVKFQEVKMQEHSDQVPVGHIPRSMTIMCRGEVTRMAQPGDHIVVSGVFLPLMRTGFAQMIQGLLSETFLQAHRIICINKNDEISDKDAELTPEELEELAQDDFYERLATSLAPEIYGHLDVKKALLLLLVGGVDKRPDGMKIRGNINICLMGDPGVAKSQLLGYISRLAVRSQYTTGRGSSGVGLTAAVMKDPLTGEMTLEGGALVLADQGVCCIDEFDKMADQDRTAIHEVMEQQTISIAKAGIMTTLNARVSILAAANPAFGRYNPRRTVEQNIQLPAALLSRFDLLWLIQDKPDRDNDLRLAKHITYVHSHSKQPPTRVKALDMNLMRRYINLCKRKNPTIPDELTDYIVGAYVELRREARNQKDMTFTSARNLLGILRLSTALARLRLSDSVEKDDVAEALRLLEMSKDSLNQIHEHQKGHVPNTSDRIFAIVRELAGSGKAVKISDIMDRCTTKGFKPDQVDKCIDDYEELNVWQVNMGRTKITFM",
                "length": 720
            },
            "evidence": [
                {
                    "id": "A6KSS8",
                    "url": "https://omabrowser.org/oma/group/A6KSS8/",
                    "database": "OMA"
                }
            ],
            "glygen_name": "Fruit fly",
            "common_name": "Fruit fly"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 14,
                "go_terms": [
                    {
                        "name": "DNA strand elongation involved in DNA replication",
                        "id": "GO:0006271",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006271",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cell population proliferation",
                        "id": "GO:0008283",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008283",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of DNA-templated transcription",
                        "id": "GO:0006355",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cellular response to xenobiotic stimulus",
                        "id": "GO:0071466",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071466",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "DNA replication",
                        "id": "GO:0006260",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006260",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "DNA damage response",
                        "id": "GO:0006974",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006974",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cellular response to organic substance",
                        "id": "GO:0071310",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071310",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cell cycle",
                        "id": "GO:0007049",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007049",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "response to xenobiotic stimulus",
                        "id": "GO:0009410",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cellular response to epidermal growth factor stimulus",
                        "id": "GO:0071364",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071364",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "DNA replication initiation",
                        "id": "GO:0006270",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006270",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "double-strand break repair via break-induced replication",
                        "id": "GO:0000727",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000727",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of phosphorylation",
                        "id": "GO:0042325",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042325",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "DNA unwinding involved in DNA replication",
                        "id": "GO:0006268",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006268",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 7,
                "go_terms": [
                    {
                        "name": "DNA binding",
                        "id": "GO:0003677",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ATP binding",
                        "id": "GO:0005524",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ATP hydrolysis activity",
                        "id": "GO:0016887",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016887",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "single-stranded DNA binding",
                        "id": "GO:0003697",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003697",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "DNA helicase activity",
                        "id": "GO:0003678",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003678",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ATP-dependent activity, acting on DNA",
                        "id": "GO:0008094",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008094",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "hydrolase activity",
                        "id": "GO:0016787",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016787",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 3,
                "go_terms": [
                    {
                        "name": "nucleus",
                        "id": "GO:0005634",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "MCM complex",
                        "id": "GO:0042555",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042555",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "CMG complex",
                        "id": "GO:0071162",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071162",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6KSS8",
                                "url": "https://www.uniprot.org/uniprot/A6KSS8"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 214,
            "end_pos": 216,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 710,
            "end_pos": 712,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [
        {
            "id": "13065",
            "name": "",
            "equation": "ATP + H2O = ADP + H(+) + phosphate",
            "summary": "",
            "cellular_location": "",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "D3ZD32-1",
                "D4A523-1",
                "Q3MHU3-1",
                "F1M298-1",
                "Q5RJZ1-1",
                "P60123-1",
                "Q793F9-1",
                "F1LPQ2-1",
                "G3V681-1",
                "F1LNJ2-1",
                "D4A2Z8-1",
                "Q5RKI1-1",
                "P70486-1",
                "Q66HG7-1",
                "Q99PT0-1",
                "D3ZG52-1",
                "Q4G005-1",
                "Q5U216-1",
                "Q62780-1",
                "Q641Y8-1",
                "Q5BJS0-1",
                "Q63413-1",
                "Q64060-1",
                "Q9JIX5-1",
                "P06761-1",
                "Q6GX84-1",
                "Q5XI69-1",
                "Q9QUL6-1",
                "Q1HG60-1",
                "Q3B8Q2-1",
                "P46462-1",
                "D3ZA12-1",
                "D3Z9Z9-1",
                "Q68G38-1",
                "Q9QY16-1",
                "A0A8I5ZZZ0-1",
                "A0A0G2K0H9-1",
                "Q6AYJ1-1",
                "Q62724-1",
                "Q5EBA1-1",
                "Q3B8Q1-1",
                "Q9EQN5-1",
                "F1M9L4-1",
                "F1M5F3-1",
                "D3ZFP4-1",
                "F1MA70-1",
                "D3ZBY5-1",
                "D3ZX56-1",
                "D3ZVK1-1",
                "B1H269-1",
                "Q9WTT2-1",
                "G3V8T5-1",
                "Q8CG07-1",
                "B2GUX3-1",
                "P08289-1",
                "D3ZP96-1",
                "D3ZHW0-1",
                "Q5XIR6-1",
                "A0A8I6AFW4-1",
                "Q5XI46-1",
                "A0A0G2KA92-1",
                "D4AAG9-1",
                "A0A096MJV7-1",
                "A0A0G2JTM6-1",
                "A0A8I5ZKV9-1",
                "A0A8I5ZKH1-1",
                "D3ZD46-1",
                "A0A8I6GIY0-1",
                "E9PU01-1",
                "A0A8I6ABZ7-1",
                "D3ZAP7-1",
                "D3ZQW1-1",
                "D4A321-1",
                "A0A0G2K283-1",
                "Q6MG13-1",
                "P62738-1",
                "P63259-1",
                "P68035-1",
                "P68136-1",
                "P60711-1",
                "P63269-1",
                "P56536-1",
                "P54777-1",
                "D3ZSV6-1",
                "D3ZUC2-1",
                "G3V6W5-1",
                "D3ZD97-1",
                "F1LTH9-1",
                "D3ZEG9-1",
                "A6KAR2-1",
                "P63018-1",
                "P82995-1",
                "D4ADT5-1",
                "D4A6Q6-1",
                "A0A8I5ZMZ5-1",
                "D4ACP5-1",
                "A0A8I6GIN4-1",
                "A6KSS8-1",
                "D4A2B7-1",
                "A0A0G2K4S4-1",
                "A0A8I6AK63-1",
                "F1LTR3-1",
                "F1LWY1-1",
                "D4A1R0-1",
                "P97687-1",
                "Q641Z7-1",
                "Q5EB68-1",
                "D4A628-1"
            ],
            "evidence": [
                {
                    "id": "13065",
                    "database": "Rhea",
                    "url": "https://www.rhea-db.org/rhea/13065"
                }
            ]
        }
    ],
    "reaction_participants": [],
    "reaction_enzymes": [
        {
            "uniprot_ac": "A0A096MJV7",
            "gene_name": "Chd9",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "A0A096MJV7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A096MJV7"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A096MJV7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A096MJV7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A0G2JTM6",
            "gene_name": "Dhx35",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "A0A0G2JTM6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2JTM6"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A0G2JTM6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2JTM6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A0G2K0H9",
            "gene_name": "Ruvbl1-ps1",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "A0A0G2K0H9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2K0H9"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A0G2K0H9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2K0H9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A0G2K283",
            "gene_name": "Dhx8",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "A0A0G2K283",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2K283"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A0G2K283",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2K283"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A0G2K4S4",
            "gene_name": "Ddx51",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "A0A0G2K4S4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2K4S4"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A0G2K4S4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2K4S4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A0G2KA92",
            "gene_name": "Chd2",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "A0A0G2KA92",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2KA92"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A0G2KA92",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2KA92"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I5ZKH1",
            "gene_name": "Ythdc2",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "A0A8I5ZKH1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZKH1"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I5ZKH1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZKH1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I5ZKV9",
            "gene_name": "Ddx5",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "A0A8I5ZKV9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZKV9"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I5ZKV9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZKV9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I5ZMZ5",
            "gene_name": "LOC100912568",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "A0A8I5ZMZ5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZMZ5"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I5ZMZ5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZMZ5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I5ZZZ0",
            "gene_name": "Ddx31",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "A0A8I5ZZZ0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZZZ0"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I5ZZZ0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZZZ0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I6ABZ7",
            "gene_name": "Dhx9",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "A0A8I6ABZ7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6ABZ7"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I6ABZ7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6ABZ7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I6AFW4",
            "gene_name": "Ddx24",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "A0A8I6AFW4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6AFW4"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I6AFW4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6AFW4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I6AK63",
            "gene_name": "ENSRNOG00000069014",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "A0A8I6AK63",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6AK63"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I6AK63",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6AK63"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I6GIN4",
            "gene_name": "AC129365.1",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "A0A8I6GIN4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6GIN4"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I6GIN4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6GIN4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I6GIY0",
            "gene_name": "Chd3",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "A0A8I6GIY0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6GIY0"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I6GIY0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6GIY0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A6KAR2",
            "gene_name": "Ddx41",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "A6KAR2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A6KAR2"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A6KAR2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A6KAR2"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A6KSS8",
            "gene_name": "Mcm7",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "A6KSS8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A6KSS8"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A6KSS8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A6KSS8"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "B1H269",
            "gene_name": "Ddx27",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "B1H269",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B1H269"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "B1H269",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B1H269"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "B2GUX3",
            "gene_name": "Mcm5",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "B2GUX3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B2GUX3"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "B2GUX3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B2GUX3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3Z9Z9",
            "gene_name": "Smarcad1",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D3Z9Z9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3Z9Z9"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3Z9Z9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3Z9Z9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZA12",
            "gene_name": "Chd6",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D3ZA12",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZA12"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZA12",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZA12"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZAP7",
            "gene_name": "Chd7",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D3ZAP7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZAP7"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZAP7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZAP7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZBY5",
            "gene_name": "Ddx10",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D3ZBY5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZBY5"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZBY5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZBY5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZD32",
            "gene_name": "Chd5",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D3ZD32",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZD32"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZD32",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZD32"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZD46",
            "gene_name": "Dhx58",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D3ZD46",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZD46"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZD46",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZD46"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZD97",
            "gene_name": "Dhx15",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D3ZD97",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZD97"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZD97",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZD97"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZEG9",
            "gene_name": "Ercc2",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D3ZEG9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZEG9"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZEG9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZEG9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZFP4",
            "gene_name": "Mcm3",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D3ZFP4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZFP4"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZFP4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZFP4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZG52",
            "gene_name": "Dna2",
            "activity": [
                {
                    "ec_number": "3.1.-.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZG52",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZG52"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D3ZG52",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZG52"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZG52",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZG52"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZHW0",
            "gene_name": "Dhx29",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D3ZHW0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZHW0"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZHW0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZHW0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZP96",
            "gene_name": "Mcm2",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D3ZP96",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZP96"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZP96",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZP96"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZQW1",
            "gene_name": "Blm",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D3ZQW1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZQW1"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZQW1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZQW1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZSV6",
            "gene_name": "Dhx33",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D3ZSV6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZSV6"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZSV6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZSV6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZUC2",
            "gene_name": "Mov10",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D3ZUC2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZUC2"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZUC2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZUC2"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZVK1",
            "gene_name": "Mcm8",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D3ZVK1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZVK1"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZVK1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZVK1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZX56",
            "gene_name": "Ddx55",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D3ZX56",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZX56"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZX56",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZX56"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D4A1R0",
            "gene_name": "Dhx37",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D4A1R0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A1R0"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4A1R0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A1R0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D4A2B7",
            "gene_name": "Afg2b",
            "activity": [
                {
                    "ec_number": "3.6.4.10",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D4A2B7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A2B7"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.10",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4A2B7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A2B7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D4A2Z8",
            "gene_name": "Dhx36",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D4A2Z8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A2Z8"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D4A2Z8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A2Z8"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4A2Z8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A2Z8"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4A2Z8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A2Z8"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D4A321",
            "gene_name": "Dhx38",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D4A321",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A321"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4A321",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A321"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D4A523",
            "gene_name": "Nlrp3",
            "activity": [
                {
                    "ec_number": "3.6.4.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4A523",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A523"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D4A628",
            "gene_name": "Polq",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D4A628",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A628"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4A628",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A628"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D4A6Q6",
            "gene_name": "Ino80",
            "activity": [
                {
                    "ec_number": "3.6.4.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4A6Q6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A6Q6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D4AAG9",
            "gene_name": "Chd1",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D4AAG9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4AAG9"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4AAG9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4AAG9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D4ACP5",
            "gene_name": "Recql5",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D4ACP5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4ACP5"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4ACP5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4ACP5"
                        }
                    ]
                },
                {
                    "ec_number": "5.6.2.4",
                    "activity": "Couples ATP hydrolysis with the unwinding of duplex DNA by translocating in the 3'-5' direction.",
                    "evidence": [
                        {
                            "id": "D4ACP5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4ACP5"
                        }
                    ]
                },
                {
                    "ec_number": "5.6.2.4",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4ACP5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4ACP5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D4ADT5",
            "gene_name": "Rig1",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "D4ADT5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4ADT5"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4ADT5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4ADT5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "E9PU01",
            "gene_name": "Chd4",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "E9PU01",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/E9PU01"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "E9PU01",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/E9PU01"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LNJ2",
            "gene_name": "Snrnp200",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "F1LNJ2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LNJ2"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LNJ2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LNJ2"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LPQ2",
            "gene_name": "Ascc3",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "F1LPQ2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LPQ2"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LPQ2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LPQ2"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LTH9",
            "gene_name": "Wrn",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "F1LTH9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LTH9"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LTH9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LTH9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LTR3",
            "gene_name": "Tdrd12",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "F1LTR3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LTR3"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LTR3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LTR3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LWY1",
            "gene_name": "Hfm1",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "F1LWY1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LWY1"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LWY1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LWY1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1M298",
            "gene_name": "Fbh1",
            "activity": [
                {
                    "ec_number": "5.6.2.4",
                    "activity": "Couples ATP hydrolysis with the unwinding of duplex DNA by translocating in the 3'-5' direction.",
                    "evidence": [
                        {
                            "id": "F1M298",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1M298"
                        }
                    ]
                },
                {
                    "ec_number": "5.6.2.4",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1M298",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1M298"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1M5F3",
            "gene_name": "Mcm9",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "F1M5F3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1M5F3"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1M5F3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1M5F3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1M9L4",
            "gene_name": "Atp13a4",
            "activity": [
                {
                    "ec_number": "7.2.2.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1M9L4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1M9L4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1MA70",
            "gene_name": "Atp13a5",
            "activity": [
                {
                    "ec_number": "7.2.2.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1MA70",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1MA70"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "G3V681",
            "gene_name": "Mcm4",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "G3V681",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V681"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "G3V681",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V681"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "G3V6W5",
            "gene_name": "Ifih1",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "G3V6W5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V6W5"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "G3V6W5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V6W5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "G3V8T5",
            "gene_name": "Ruvbl2",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "G3V8T5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V8T5"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "G3V8T5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V8T5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P06761",
            "gene_name": "Hspa5",
            "activity": [
                {
                    "ec_number": "3.6.4.10",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "P06761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06761"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.10",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P06761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06761"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08289",
            "gene_name": "Alpl",
            "activity": [
                {
                    "ec_number": "3.1.3.1",
                    "activity": "a phosphate monoester + H2O = an alcohol + phosphate.",
                    "evidence": [
                        {
                            "id": "P08289",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08289"
                        }
                    ]
                },
                {
                    "ec_number": "3.9.1.1",
                    "activity": "H2O + N-phosphocreatine = creatine + phosphate.",
                    "evidence": [
                        {
                            "id": "P08289",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08289"
                        }
                    ]
                },
                {
                    "ec_number": "3.1.3.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08289",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08289"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P46462",
            "gene_name": "Vcp",
            "activity": [
                {
                    "ec_number": "3.6.4.6",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "P46462",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P46462"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.6",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P46462",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P46462"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54777",
            "gene_name": "Pex6",
            "activity": [
                {
                    "ec_number": "3.6.4.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54777",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54777"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P56536",
            "gene_name": "Kif5c",
            "activity": [
                {
                    "ec_number": "3.6.4.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P56536",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P56536"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P60123",
            "gene_name": "Ruvbl1",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "P60123",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P60123"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P60123",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P60123"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P60711",
            "gene_name": "Actb",
            "activity": [
                {
                    "ec_number": "3.6.4.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P60711",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P60711"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P62738",
            "gene_name": "Acta2",
            "activity": [
                {
                    "ec_number": "3.6.4.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P62738",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P62738"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P63018",
            "gene_name": "Hspa8",
            "activity": [
                {
                    "ec_number": "3.6.4.10",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "P63018",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P63018"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.10",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P63018",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P63018"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P63259",
            "gene_name": "Actg1",
            "activity": [
                {
                    "ec_number": "3.6.4.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P63259",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P63259"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P63269",
            "gene_name": "Actg2",
            "activity": [
                {
                    "ec_number": "3.6.4.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P63269",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P63269"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P68035",
            "gene_name": "Actc1",
            "activity": [
                {
                    "ec_number": "3.6.4.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P68035",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P68035"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P68136",
            "gene_name": "Acta1",
            "activity": [
                {
                    "ec_number": "3.6.4.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P68136",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P68136"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P70486",
            "gene_name": "Atrx",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "P70486",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70486"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P70486",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70486"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P82995",
            "gene_name": "Hsp90aa1",
            "activity": [
                {
                    "ec_number": "3.6.4.10",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "P82995",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P82995"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.10",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P82995",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P82995"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P97687",
            "gene_name": "Entpd1",
            "activity": [
                {
                    "ec_number": "3.6.1.5",
                    "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + 2 H2O = a 2'-deoxyribonucleoside 5'-phosphate + 2 H(+) + 2 phosphate.",
                    "evidence": [
                        {
                            "id": "P97687",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97687"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.1.5",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P97687",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97687"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q1HG60",
            "gene_name": "Pif1",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q1HG60",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q1HG60"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q1HG60",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q1HG60"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q3B8Q1",
            "gene_name": "Ddx21",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q3B8Q1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q3B8Q1"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q3B8Q1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q3B8Q1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q3B8Q2",
            "gene_name": "Eif4a3",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q3B8Q2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q3B8Q2"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q3B8Q2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q3B8Q2"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q3MHU3",
            "gene_name": "Tdrd9",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q3MHU3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q3MHU3"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q3MHU3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q3MHU3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q4G005",
            "gene_name": "Ercc3",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q4G005",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4G005"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q4G005",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4G005"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5BJS0",
            "gene_name": "Dhx30",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q5BJS0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5BJS0"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5BJS0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5BJS0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5EB68",
            "gene_name": "Ak6",
            "activity": [
                {
                    "ec_number": "2.7.4.3",
                    "activity": "AMP + ATP = 2 ADP.",
                    "evidence": [
                        {
                            "id": "Q5EB68",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5EB68"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.4.3",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5EB68",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5EB68"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5EBA1",
            "gene_name": "Supv3l1",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q5EBA1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5EBA1"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5EBA1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5EBA1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5RJZ1",
            "gene_name": "Rtel1",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q5RJZ1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5RJZ1"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5RJZ1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5RJZ1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5RKI1",
            "gene_name": "Eif4a2",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q5RKI1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5RKI1"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5RKI1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5RKI1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5U216",
            "gene_name": "Ddx39a",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q5U216",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U216"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5U216",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U216"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5XI46",
            "gene_name": "Paat",
            "activity": [
                {
                    "ec_number": "3.6.1.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5XI46",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5XI46"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5XI69",
            "gene_name": "Dhx40",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q5XI69",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5XI69"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5XI69",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5XI69"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5XIR6",
            "gene_name": "Iqcd",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q5XIR6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5XIR6"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5XIR6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5XIR6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62724",
            "gene_name": "Mcm6",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q62724",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62724"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62724",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62724"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62780",
            "gene_name": "Ddx46",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q62780",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62780"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62780",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62780"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63413",
            "gene_name": "Ddx39b",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q63413",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63413"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63413",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63413"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q64060",
            "gene_name": "Ddx4",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q64060",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64060"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q64060",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64060"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q641Y8",
            "gene_name": "Ddx1",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q641Y8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q641Y8"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q641Y8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q641Y8"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q641Z7",
            "gene_name": "Smpdl3a",
            "activity": [
                {
                    "ec_number": "3.6.1.15",
                    "activity": "a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q641Z7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q641Z7"
                        }
                    ]
                },
                {
                    "ec_number": "3.1.4.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q641Z7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q641Z7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q66HG7",
            "gene_name": "Ddx59",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q66HG7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q66HG7"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q66HG7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q66HG7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q68G38",
            "gene_name": "Tor1a",
            "activity": [
                {
                    "ec_number": "3.6.4.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q68G38",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q68G38"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6AYJ1",
            "gene_name": "Recql",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q6AYJ1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6AYJ1"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6AYJ1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6AYJ1"
                        }
                    ]
                },
                {
                    "ec_number": "5.6.2.4",
                    "activity": "Couples ATP hydrolysis with the unwinding of duplex DNA by translocating in the 3'-5' direction.",
                    "evidence": [
                        {
                            "id": "Q6AYJ1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6AYJ1"
                        }
                    ]
                },
                {
                    "ec_number": "5.6.2.4",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6AYJ1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6AYJ1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6GX84",
            "gene_name": "Fignl1",
            "activity": [
                {
                    "ec_number": "3.6.4.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6GX84",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6GX84"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6MG13",
            "gene_name": "Dhx16",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q6MG13",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6MG13"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6MG13",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6MG13"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q793F9",
            "gene_name": "Vps4a",
            "activity": [
                {
                    "ec_number": "3.6.4.6",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q793F9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q793F9"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.6",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q793F9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q793F9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8CG07",
            "gene_name": "Wrnip1",
            "activity": [
                {
                    "ec_number": "3.6.1.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8CG07",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8CG07"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q99PT0",
            "gene_name": "Ddx52",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q99PT0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q99PT0"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q99PT0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q99PT0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9EQN5",
            "gene_name": "Ighmbp2",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q9EQN5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9EQN5"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q9EQN5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9EQN5"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9EQN5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9EQN5"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9EQN5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9EQN5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9JIX5",
            "gene_name": "Chd8",
            "activity": [
                {
                    "ec_number": "3.6.4.12",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q9JIX5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9JIX5"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.12",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9JIX5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9JIX5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9QUL6",
            "gene_name": "Nsf",
            "activity": [
                {
                    "ec_number": "3.6.4.6",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q9QUL6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9QUL6"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.6",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9QUL6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9QUL6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9QY16",
            "gene_name": "Ddx25",
            "activity": [
                {
                    "ec_number": "3.6.4.13",
                    "activity": "ATP + H2O = ADP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q9QY16",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9QY16"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.4.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9QY16",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9QY16"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9WTT2",
            "gene_name": "Clpb",
            "activity": [
                {
                    "ec_number": "3.6.1.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9WTT2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9WTT2"
                        }
                    ]
                }
            ]
        }
    ],
    "biomarkers": [],
    "synthesized_glycans": [],
    "enzyme_annotation": [
        {
            "ec_number": "3.6.4.12",
            "ec_name": "ATP + H2O = ADP + H(+) + phosphate.",
            "evidence": [
                {
                    "id": "3.6.4.12",
                    "database": "Rhea",
                    "url": "https://www.rhea-db.org/rhea/?query=ec:3.6.4.12"
                },
                {
                    "id": "3.6.4.12",
                    "database": "BRENDA Enzymes",
                    "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.6.4.12"
                }
            ]
        }
    ],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        }
    ],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": [
            {
                "start_pos": 214,
                "end_pos": 216
            },
            {
                "start_pos": 710,
                "end_pos": 712
            }
        ]
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}