{ "uniprot_canonical_ac": "A6IIY7-1", "uniprot_ac": "A6IIY7", "uniprot_id": "A6IIY7_RAT", "mass": { "chemical_mass": 14659.0, "monoisotopic_mass": 14659.0 }, "refseq": { "ac": "NP_001008513", "name": "C-C motif chemokine 21 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008513" }, "gene_names": [ { "name": "Ccl21", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A6IIY7", "id": "A6IIY7" }, { "name": "Ccl21b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008513", "id": "NP_001008513" }, { "name": "Ccl21b", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A6IIY7", "id": "A6IIY7" }, { "name": "Ccl21", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008513", "id": "NP_001008513" } ], "protein_names": [ { "name": "C-C motif chemokine 21 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008513", "id": "NP_001008513" }, { "name": "C-C motif chemokine ligand 21", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A6IIY7/entry#names_and_taxonomy", "id": "A6IIY7" }, { "name": "Chemokine (C-C motif) ligand 21b (Serine)", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A6IIY7/entry#names_and_taxonomy", "id": "A6IIY7" }, { "name": "chemokine (C-C motif) ligand 21b (serine); small inducible cytokine A21; C-C motif chemokine 21", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008513", "id": "NP_001008513" } ], "function": [ { "annotation": "Evaluation of CCL21 role in post-knee injury inflammation and early cartilage degeneration. Erratum:[PLoS One. 2021 Oct 28;16(10):e0259553. PMID: 34710183] Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001008513", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008513" }, { "database": "PubMed", "id": "33651836", "url": "https://glygen.org/publication/PubMed/33651836" } ] }, { "annotation": "[Expression and significance of chemokines CCL21, E-selectins and Hsp90 in periodontal tissues of rats with experimental periodontitis].", "evidence": [ { "database": "RefSeq", "id": "NP_001008513", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008513" }, { "database": "PubMed", "id": "33089280", "url": "https://glygen.org/publication/PubMed/33089280" } ] } ], "disease": [ { "disease_id": "DOID:3770", "recommended_name": { "id": "DOID:3770", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3770", "name": "pulmonary fibrosis", "description": "An interstitial lung disease that is characterized by destruction, scarring, and thickening of the interstitial lung tissues and progressive pulmonary function loss in a restrictive pattern, has_symptom progressive shortness of breath, fatigue, and chronic cough, possibly has_material_basis_in exposure to certain chemicals, autoimmune conditions, and radiation." }, "synonyms": [ { "id": "DOID:3770", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3770", "name": "Fibrosis of lung", "description": "" } ], "evidence": [ { "id": "3770", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3770" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "gene": [ { "name": "Ccl21", "url": "https://www.uniprot.org/uniprot/A6IIY7", "locus": { "chromosome": "5", "start_pos": 56980558, "end_pos": 56981686, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000034290", "url": "https://www.ensembl.org/id/ENSRNOG00000034290" } ] } } ], "crossref": [ { "id": "ENSRNOG00000034290", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000034290", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "298006", "url": "https://www.ncbi.nlm.nih.gov/gene/298006", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001811", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001811", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039809", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039809", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:298006", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:298006", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "CKRTEQP", "url": "https://omabrowser.org/oma/group/CKRTEQP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5265378at2759", "url": "http://www.orthodb.org/?query=5265378at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12015", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12015", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12015:SF72", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12015:SF72", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00048", "url": "http://pfam.xfam.org/family/PF00048", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q5RJN3", "url": "http://purl.obolibrary.org/obo/PR_Q5RJN3", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001008513", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008513", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1311996", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1311996", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I5ZU27", "url": "https://www.uniprot.org/uniprot/A0A8I5ZU27", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZU27-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZU27-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6IIY7-1", "url": "https://www.uniprot.org/uniprot/A6IIY7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAQMLALSLLSLVLVLCVPWTQGSDGGGQDCCLRYSQKKIPYNIVRGYRKQEPSLGCPIPAILFAPRKQSQPELCANPEEAWVQKLMRRLDQPPAPGKQNCRKNRGTSKSGKKGRGSKGCKGTEQTDSKRVSQ", "length": 133, "header": "tr|A6IIY7-1|A6IIY7_RAT Isoform 1 of C-C motif chemokine ligand 21 OS=Rattus norvegicus OX=10116 GN=Ccl21 PE=2 SV=1 CANONICAL=A6IIY7-1" }, "isoforms": [ { "isoform_ac": "A0A8I5ZU27-1", "url": "https://www.uniprot.org/uniprotkb/A6IIY7/entry#A0A8I5ZU27-1", "sequence": { "sequence": "MAQMLALSLLSLVLVLCVPWTQGSDGGGQDCCLRYSQKKIPYNIVRGYRKQEPSLGCPIPAILFAPRKQSQPELCANPEEAWVQKLMRRLDQPPAPGKQNCRKNRGTSKSGKKGRGSKGCKG", "length": 122, "header": "tr|A0A8I5ZU27-1|A6IIY7_RAT Computationally mapped isoform of C-C motif chemokine ligand 21 OS=Rattus norvegicus OX=10116 GN=Ccl21 PE=2 SV=1 CANONICAL=A6IIY7-1" }, "locus": { "chromosome": "5", "start_pos": 56981613, "end_pos": 56981064, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000117300.1", "url": "https://www.ensembl.org/id/ENSRNOT00000117300.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000080937.1", "url": "https://www.ensembl.org/id/ENSRNOP00000080937.1" } ] } }, { "isoform_ac": "A6IIY7-1", "url": "https://www.uniprot.org/uniprotkb/A6IIY7/entry#A6IIY7-1", "sequence": { "sequence": "MAQMLALSLLSLVLVLCVPWTQGSDGGGQDCCLRYSQKKIPYNIVRGYRKQEPSLGCPIPAILFAPRKQSQPELCANPEEAWVQKLMRRLDQPPAPGKQNCRKNRGTSKSGKKGRGSKGCKGTEQTDSKRVSQ", "length": 133, "header": "tr|A6IIY7-1|A6IIY7_RAT Isoform 1 of C-C motif chemokine ligand 21 OS=Rattus norvegicus OX=10116 GN=Ccl21 PE=2 SV=1 CANONICAL=A6IIY7-1" }, "locus": { "chromosome": "5", "start_pos": 56981613, "end_pos": 56980948, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000023951.7", "url": "https://www.ensembl.org/id/ENSRNOT00000023951.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000023951.4", "url": "https://www.ensembl.org/id/ENSRNOP00000023951.4" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "[Expression and significance of chemokines CCL21, E-selectins and Hsp90 in periodontal tissues of rats with experimental periodontitis].", "journal": "Shanghai kou qiang yi xue = Shanghai journal of stomatology", "date": "2020", "authors": "Wang T, Fu J, Liu XQ, Zhang Q", "evidence": [ { "database": "RefSeq", "id": "NP_001008513", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008513" } ], "reference": [ { "type": "PubMed", "id": "33089280", "url": "https://glygen.org/publication/PubMed/33089280" } ] }, { "title": "Evaluation of CCL21 role in post-knee injury inflammation and early cartilage degeneration.", "journal": "PloS one", "date": "2021", "authors": "Subburaman M, Edderkaoui B", "evidence": [ { "database": "RefSeq", "id": "NP_001008513", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008513" } ], "reference": [ { "type": "PubMed", "id": "33651836", "url": "https://glygen.org/publication/PubMed/33651836" } ] } ], "pathway": [ { "id": "rno:298006", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:298006", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O00585-1", "protein_name": "C-C motif chemokine 21", "gene_name": "CCL21", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP", "length": 134 }, "evidence": [ { "id": "46370620", "url": "http://www.informatics.jax.org/homology/46370620", "database": "MGI" }, { "id": "46370621", "url": "http://www.informatics.jax.org/homology/46370621", "database": "MGI" }, { "id": "46370622", "url": "http://www.informatics.jax.org/homology/46370622", "database": "MGI" }, { "id": "46370623", "url": "http://www.informatics.jax.org/homology/46370623", "database": "MGI" }, { "id": "46370619", "url": "http://www.informatics.jax.org/homology/46370619", "database": "MGI" }, { "id": "A6IIY7", "url": "https://omabrowser.org/oma/group/A6IIY7/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P84444-1", "protein_name": "C-C motif chemokine 21a", "gene_name": "Ccl21a", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAQMMTLSLLSLVLALCIPWTQGSDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG", "length": 133 }, "evidence": [ { "id": "46370619", "url": "http://www.informatics.jax.org/homology/46370619", "database": "MGI" }, { "id": "A6IIY7", "url": "https://omabrowser.org/oma/group/A6IIY7/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "P86792-1", "protein_name": "C-C motif chemokine 21b", "gene_name": "Ccl21b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAQMMTLSLLSLVLALCIPWTQGSDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG", "length": 133 }, "evidence": [ { "id": "46370620", "url": "http://www.informatics.jax.org/homology/46370620", "database": "MGI" }, { "id": "46370621", "url": "http://www.informatics.jax.org/homology/46370621", "database": "MGI" }, { "id": "46370622", "url": "http://www.informatics.jax.org/homology/46370622", "database": "MGI" }, { "id": "46370623", "url": "http://www.informatics.jax.org/homology/46370623", "database": "MGI" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 45, "go_terms": [ { "name": "cellular response to chemokine", "id": "GO:1990869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990869", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "negative regulation of dendritic cell apoptotic process", "id": "GO:2000669", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000669", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "positive regulation of T cell chemotaxis", "id": "GO:0010820", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010820", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "positive regulation of JNK cascade", "id": "GO:0046330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046330", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction", "id": "GO:0051897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051897", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "chemokine-mediated signaling pathway", "id": "GO:0070098", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070098", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "positive regulation of T cell migration", "id": "GO:2000406", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000406", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "T cell costimulation", "id": "GO:0031295", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031295", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "positive regulation of cell adhesion mediated by integrin", "id": "GO:0033630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033630", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "lymphocyte chemotaxis", "id": "GO:0048247", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048247", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "positive regulation of canonical NF-kappaB signal transduction", "id": "GO:0043123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043123", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "release of sequestered calcium ion into cytosol", "id": "GO:0051209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051209", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "cell chemotaxis", "id": "GO:0060326", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060326", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "positive regulation of pseudopodium assembly", "id": "GO:0031274", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031274", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "ruffle organization", "id": "GO:0031529", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031529", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "positive regulation of receptor-mediated endocytosis", "id": "GO:0048260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048260", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "dendritic cell chemotaxis", "id": "GO:0002407", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002407", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "positive regulation of cell motility", "id": "GO:2000147", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000147", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "cellular response to type II interferon", "id": "GO:0071346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071346", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "positive regulation of filopodium assembly", "id": "GO:0051491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051491", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "cellular response to tumor necrosis factor", "id": "GO:0071356", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071356", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "positive regulation of actin filament polymerization", "id": "GO:0030838", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030838", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "monocyte chemotaxis", "id": "GO:0002548", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002548", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "cell maturation", "id": "GO:0048469", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048469", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "induction of positive chemotaxis", "id": "GO:0050930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050930", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "cellular response to interleukin-1", "id": "GO:0071347", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071347", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "dendritic cell dendrite assembly", "id": "GO:0097026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097026", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "mesangial cell-matrix adhesion", "id": "GO:0035759", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035759", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "positive regulation of chemotaxis", "id": "GO:0050921", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050921", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "positive regulation of neutrophil chemotaxis", "id": "GO:0090023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090023", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "immunological synapse formation", "id": "GO:0001771", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001771", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "positive regulation of cell-matrix adhesion", "id": "GO:0001954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001954", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "neutrophil chemotaxis", "id": "GO:0030593", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030593", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "negative regulation of leukocyte tethering or rolling", "id": "GO:1903237", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903237", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "establishment of T cell polarity", "id": "GO:0001768", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001768", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "positive regulation of dendritic cell antigen processing and presentation", "id": "GO:0002606", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002606", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "response to prostaglandin E", "id": "GO:0034695", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034695", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "positive regulation of glycoprotein biosynthetic process", "id": "GO:0010560", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010560", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "lymph node development", "id": "GO:0048535", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048535", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "positive regulation of myeloid dendritic cell chemotaxis", "id": "GO:2000529", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000529", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "negative regulation of dendritic cell dendrite assembly", "id": "GO:2000548", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000548", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "chemokine (C-C motif) ligand 21 signaling pathway", "id": "GO:0038116", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038116", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "chemokine activity", "id": "GO:0008009", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008009", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "chemokine receptor binding", "id": "GO:0042379", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042379", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "CCR chemokine receptor binding", "id": "GO:0048020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048020", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" }, { "name": "CCR7 chemokine receptor binding", "id": "GO:0031732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031732", "evidence": [ { "database": "UniProtKB", "id": "A6IIY7", "url": "https://www.uniprot.org/uniprot/A6IIY7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }