{ "uniprot_canonical_ac": "A5GFX0-1", "uniprot_ac": "A5GFX0", "uniprot_id": "PLD3B_PIG", "mass": { "chemical_mass": 21412.0, "monoisotopic_mass": 21412.0 }, "refseq": { "ac": "NP_001107169", "name": "PRELI domain containing protein 3B", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107169" }, "gene_names": [ { "name": "PRELID3B", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A5GFX0", "id": "A5GFX0" }, { "name": "C17H20orf45; SLMO2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107169", "id": "NP_001107169" }, { "name": "PRELID3B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107169", "id": "NP_001107169" }, { "name": "SLMO2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A5GFX0", "id": "A5GFX0" } ], "protein_names": [ { "name": "PRELI domain containing protein 3B", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A5GFX0/entry#names_and_taxonomy", "id": "A5GFX0" }, { "name": "PRELI domain containing protein 3B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107169", "id": "NP_001107169" }, { "name": "Protein slowmo homolog 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107169", "id": "NP_001107169" }, { "name": "Protein slowmo homolog 2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A5GFX0/entry#names_and_taxonomy", "id": "A5GFX0" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Sus scrofa", "taxid": 9823, "evidence": [ { "database": "UniProtKB", "id": "A5GFX0", "url": "https://www.uniprot.org/uniprot/A5GFX0" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" } ], "gene": [ { "name": "PRELID3B", "url": "https://www.uniprot.org/uniprot/A5GFX0", "locus": { "chromosome": "17", "start_pos": 59175776, "end_pos": 59185000, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSSSCG00000007525", "url": "https://www.ensembl.org/id/ENSSSCG00000007525" } ] } } ], "crossref": [ { "id": "ENSSSCG00000007525", "url": "https://bgee.org/?page=gene&gene_id=ENSSSCG00000007525", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "100134984", "url": "https://www.ncbi.nlm.nih.gov/gene/100134984", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR006797", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006797", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037365", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037365", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ssc:100134984", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ssc:100134984", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "ARMKTYV", "url": "https://omabrowser.org/oma/group/ARMKTYV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "6048at2759", "url": "http://www.orthodb.org/?query=6048at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11158", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11158", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11158:SF22", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11158:SF22", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04707", "url": "http://pfam.xfam.org/family/PF04707", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001107169", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107169", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A287AXX7", "url": "https://www.uniprot.org/uniprot/A0A287AXX7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A287AXX7-1", "url": "https://www.uniprot.org/uniprot/A0A287AXX7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A5GFX0", "url": "https://www.uniprot.org/uniprot/A5GFX0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A5GFX0-1", "url": "https://www.uniprot.org/uniprot/A5GFX0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKIWTSEHVFDHPWETVTTAAMQKYPNPMNPSVVGVDVLDRHIDASGKLHSHRLLSTEWGLPSIVKSIIGAARTKTYVQEHSVVDPVAKTMELKSTNISFTNMVSVDERLIYKPHPQDSEKTVLTQEAIITVKGVSLGSYLEGLMASTISSNANKGREAMEWVIHKLNAEIEELTASARGSIRTPMAAAAFVEK", "length": 194, "header": "sp|A5GFX0-1|PLD3B_PIG Isoform 1 of PRELI domain containing protein 3B OS=Sus scrofa OX=9823 GN=PRELID3B PE=3 SV=1 CANONICAL=A5GFX0-1" }, "isoforms": [ { "isoform_ac": "A0A287AXX7-1", "url": "https://www.uniprot.org/uniprotkb/A5GFX0/entry#A0A287AXX7-1", "sequence": { "sequence": "MKIWTSEHVFDHPWETVTTAAMQKYPNPMNPSVVGVDVLDRHIDASGKLHSHRLLSTEWGLPSIVKSISFTNMVSVDERLIYKPHPQDSEKTVLTQEAIITVKGVSLGSYLEGLMASTISSNANKGREAMEWVIHKLNAEIEELTASARGSIRTPMAAAAFVEK", "length": 164, "header": "tr|A0A287AXX7-1|A0A287AXX7_PIG Computationally mapped isoform of PRELI domain containing protein 3B OS=Sus scrofa OX=9823 GN=PRELID3B PE=3 SV=2 CANONICAL=A5GFX0-1" }, "locus": { "chromosome": "17", "start_pos": 59184880, "end_pos": 59176967, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSSSCT00000036190.3", "url": "https://www.ensembl.org/id/ENSSSCT00000036190.3" }, { "database": "Ensembl Peptide", "id": "ENSSSCP00000048739.2", "url": "https://www.ensembl.org/id/ENSSSCP00000048739.2" } ] } }, { "isoform_ac": "A5GFX0-1", "url": "https://www.uniprot.org/uniprotkb/A5GFX0/entry#A5GFX0-1", "sequence": { "sequence": "MKIWTSEHVFDHPWETVTTAAMQKYPNPMNPSVVGVDVLDRHIDASGKLHSHRLLSTEWGLPSIVKSIIGAARTKTYVQEHSVVDPVAKTMELKSTNISFTNMVSVDERLIYKPHPQDSEKTVLTQEAIITVKGVSLGSYLEGLMASTISSNANKGREAMEWVIHKLNAEIEELTASARGSIRTPMAAAAFVEK", "length": 194, "header": "sp|A5GFX0-1|PLD3B_PIG Isoform 1 of PRELI domain containing protein 3B OS=Sus scrofa OX=9823 GN=PRELID3B PE=3 SV=1 CANONICAL=A5GFX0-1" }, "locus": { "chromosome": "17", "start_pos": 59184880, "end_pos": 59176967, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSSSCT00000008252.4", "url": "https://www.ensembl.org/id/ENSSSCT00000008252.4" }, { "database": "Ensembl Peptide", "id": "ENSSSCP00000008033.2", "url": "https://www.ensembl.org/id/ENSSSCP00000008033.2" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 46, "end_pos": 46, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A5GFX0", "url": "https://www.uniprot.org/uniprot/A5GFX0" } ], "site_lbl": "Ser46" }, { "start_pos": 51, "end_pos": 51, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A5GFX0", "url": "https://www.uniprot.org/uniprot/A5GFX0" } ], "site_lbl": "Ser51" } ], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "ssc:100134984", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ssc:100134984", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "phosphatidic acid transfer activity", "id": "GO:1990050", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990050", "evidence": [ { "database": "UniProtKB", "id": "A5GFX0", "url": "https://www.uniprot.org/uniprot/A5GFX0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "mitochondrial intermembrane space", "id": "GO:0005758", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005758", "evidence": [ { "database": "UniProtKB", "id": "A5GFX0", "url": "https://www.uniprot.org/uniprot/A5GFX0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "phospholipid transport", "id": "GO:0015914", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015914", "evidence": [ { "database": "UniProtKB", "id": "A5GFX0", "url": "https://www.uniprot.org/uniprot/A5GFX0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 97, "end_pos": 99, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 46, 51 ], "sequon_annotation_sites": [ { "start_pos": 97, "end_pos": 99 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }