{ "uniprot_canonical_ac": "A4L691-1", "uniprot_ac": "A4L691", "uniprot_id": "PINX1_RAT", "mass": { "chemical_mass": 36710.0, "monoisotopic_mass": 36710.0 }, "refseq": { "ac": "NP_001076806", "name": "PIN2/TERF1-interacting telomerase inhibitor 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001076806" }, "gene_names": [ { "name": "Pinx1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A4L691", "id": "A4L691" }, { "name": "Pinx1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001076806", "id": "NP_001076806" }, { "name": "RGD1566025", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001076806", "id": "NP_001076806" } ], "protein_names": [ { "name": "PIN2/TERF1-interacting telomerase inhibitor 1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A4L691/entry#names_and_taxonomy", "id": "A4L691" }, { "name": "PIN2/TERF1-interacting telomerase inhibitor 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001076806", "id": "NP_001076806" }, { "name": "Pin2-interacting protein X1; PIN2-interacting protein 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001076806", "id": "NP_001076806" }, { "name": "Pin2-interacting protein X1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A4L691/entry#names_and_taxonomy", "id": "A4L691" } ], "function": [ { "annotation": "Microtubule-binding protein essential for faithful chromosome segregation. Mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. Inhibits telomerase activity. May inhibit cell proliferation and act as tumor suppressor (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691#function" }, { "database": "PubMed", "id": "17624691", "url": "https://glygen.org/publication/PubMed/17624691" } ] }, { "annotation": "Regulation of PINX1 expression ameliorates lipopolysaccharide-induced lung injury and alleviates cell senescence during the convalescent phase through affecting the telomerase activity.", "evidence": [ { "database": "RefSeq", "id": "NP_001076806", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001076806" }, { "database": "PubMed", "id": "33819185", "url": "https://glygen.org/publication/PubMed/33819185" } ] } ], "disease": [ { "disease_id": "DOID:162", "recommended_name": { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "cancer", "description": "A disease of cellular proliferation that is malignant and primary, characterized by uncontrolled cellular proliferation, local cell invasion and metastasis." }, "synonyms": [ { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "malignant neoplasm", "description": "" }, { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "malignant tumor", "description": "" }, { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "primary cancer", "description": "" } ], "evidence": [ { "id": "162", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:162" } ] }, { "disease_id": "DOID:684", "recommended_name": { "id": "DOID:684", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:684", "name": "hepatocellular carcinoma", "description": "A liver carcinoma that has_material_basis_in undifferentiated hepatocytes and located_in the liver." }, "synonyms": [ { "id": "DOID:684", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:684", "name": "Hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "A malignant tumor that arises from hepatocytes. Hepatocellular carcinoma is relatively rare in the United States but very common in all African countries south of the Sahara and in Southeast Asia. Most cases are seen in patients over the age of 50 years, but this tumor can also occur in younger individuals and even in children. Hepatocellular carcinoma is more common in males than females and is associated with hepatitis B, hepatitis C, chronic alcohol abuse and cirrhosis. Serum elevation of alpha-fetoprotein occurs in a large percentage of patients with hepatocellular carcinoma. Grossly, hepatocellular carcinoma may present as a single mass, as multiple nodules, or as diffuse liver involvement. Microscopically, there is a wide range of differentiation from tumor to tumor (well differentiated to poorly differentiated tumors). Hepatocellular carcinomas quickly metastasize to regional lymph nodes and lung. The overall median survival of untreated liver cell carcinoma is about 4 months. The most effective treatment of hepatocellular carcinoma is complete resection of the tumor. Lately, an increasing number of tumors have been treated with liver transplantation." }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "HCC", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "cancer, hepatocellular", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma, hepatocellular, malignant", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular adenocarcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, childhood type, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell cancer (hepatocellular carcinoma)", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult primary hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma caused by somatic mutation", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver and intrahepatic bile duct carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "A malignant tumor that arises from hepatocytes. Hepatocellular carcinoma is relatively rare in the United States but very common in all African countries south of the Sahara and in Southeast Asia. Most cases are seen in patients over the age of 50 years, but this tumor can also occur in younger individuals and even in children. Hepatocellular carcinoma is more common in males than females and is associated with hepatitis B, hepatitis C, chronic alcohol abuse and cirrhosis. Serum elevation of alpha-fetoprotein occurs in a large percentage of patients with hepatocellular carcinoma. Grossly, hepatocellular carcinoma may present as a single mass, as multiple nodules, or as diffuse liver involvement. Microscopically, there is a wide range of differentiation from tumor to tumor (well differentiated to poorly differentiated tumors). Hepatocellular carcinomas quickly metastasize to regional lymph nodes and lung. The overall median survival of untreated liver cell carcinoma is about 4 months. The most effective treatment of hepatocellular carcinoma is complete resection of the tumor. Lately, an increasing number of tumors have been treated with liver transplantation." }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "HCC", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "cancer, hepatocellular", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma, hepatocellular, malignant", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular adenocarcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, childhood type, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell cancer (hepatocellular carcinoma)", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult primary hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma caused by somatic mutation", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver and intrahepatic bile duct carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cancer", "description": "" }, { "id": "MIM:114550", "resource": "MIM", "url": "https://www.omim.org/entry/114550", "name": "Hepatocellular carcinoma", "description": "Hepatocellular carcinoma" } ], "evidence": [ { "id": "684", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:684" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "gene": [ { "name": "Pinx1", "url": "https://www.uniprot.org/uniprot/A4L691", "locus": { "chromosome": "15", "start_pos": 38157140, "end_pos": 38097886, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000012012", "url": "https://www.ensembl.org/id/ENSRNOG00000012012" } ] } } ], "crossref": [ { "id": "ENSRNOG00000012012", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000012012", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "305963", "url": "https://www.ncbi.nlm.nih.gov/gene/305963", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000467", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000467", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:305963", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:305963", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PCWDQSS", "url": "https://omabrowser.org/oma/group/PCWDQSS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2919396at2759", "url": "http://www.orthodb.org/?query=2919396at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23149", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23149", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23149:SF27", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23149:SF27", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01585", "url": "http://pfam.xfam.org/family/PF01585", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A4L691", "url": "http://purl.obolibrary.org/obo/PR_A4L691", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001076806", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001076806", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1566025", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1566025", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I6A1H3", "url": "https://www.uniprot.org/uniprot/A0A8I6A1H3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A1H3-1", "url": "https://www.uniprot.org/uniprot/A0A8I6A1H3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A4L691-1", "url": "https://www.uniprot.org/uniprot/A4L691-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSMLAERRRKQKWAVDPRNTAWSNDDSKFGQKMLEKMGWSKGKGLGAQEQGATEHIKVKVKNNHLGLGATNNNEDNWIAHQDDFNQLLAALNTCHGQETADSSDNKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSETDLDCIFGKRRNKKLAQDGCSNSTADEADTSLTTTTTTTSAFTIQEYFAKRMAQLKSKSQAAAPGSDLSETPIEWKKGKKKTKEAAGTDIENSPQHKAKRHKKKKRVEAERGPAAKKRDQVELQPGGPSGDECSDASVEAAEDRVQTPDTQDDVPKPRKRRAKKTLQRPGGVAVDTAPDSAPVKKKKKVSR", "length": 331, "header": "sp|A4L691-1|PINX1_RAT Isoform 1 of PIN2/TERF1-interacting telomerase inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Pinx1 PE=1 SV=1 CANONICAL=A4L691-1" }, "isoforms": [ { "isoform_ac": "A0A8I6A1H3-1", "url": "https://www.uniprot.org/uniprotkb/A4L691/entry#A0A8I6A1H3-1", "sequence": { "sequence": "MPPVIRRQSPLSRSLTLRDGSPMPLSSGPAPLCCLGFSYQKGRRKQKWAVDPRNTAWSNDDSKFGQKMLEKMGWSKGKGLGAQEQGATEHIKVKVKNNHLGLGATNNNEDNWIAHQDDFNQLLAALNTCHGQETADSSDNKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSETDLDCIFGKRRNKKLAQDGCSNSTADEADTSLTTTTTTTSAFTIQEYFAKRMAQLKSKSQAAAPGSDLSETPIEWKKGKKKTKEAAGTDIENSPQHKAKRHKKKKRVEAERGPAAKKRDQVELQPGGPSGDECSDASVEAAEDRVQTPDTQDDVPKPRKRRAKKTLQRPGGVAVDTAPDSAPVKKKKKVSR", "length": 366, "header": "tr|A0A8I6A1H3-1|A0A8I6A1H3_RAT Computationally mapped isoform of PIN2/TERF1 interacting, telomerase inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Pinx1 PE=1 SV=1 CANONICAL=A4L691-1" }, "locus": { "chromosome": "15", "start_pos": 38156905, "end_pos": 38101209, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000102140.1", "url": "https://www.ensembl.org/id/ENSRNOT00000102140.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000085367.1", "url": "https://www.ensembl.org/id/ENSRNOP00000085367.1" } ] } }, { "isoform_ac": "A4L691-1", "url": "https://www.uniprot.org/uniprotkb/A4L691/entry#A4L691-1", "sequence": { "sequence": "MSMLAERRRKQKWAVDPRNTAWSNDDSKFGQKMLEKMGWSKGKGLGAQEQGATEHIKVKVKNNHLGLGATNNNEDNWIAHQDDFNQLLAALNTCHGQETADSSDNKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSETDLDCIFGKRRNKKLAQDGCSNSTADEADTSLTTTTTTTSAFTIQEYFAKRMAQLKSKSQAAAPGSDLSETPIEWKKGKKKTKEAAGTDIENSPQHKAKRHKKKKRVEAERGPAAKKRDQVELQPGGPSGDECSDASVEAAEDRVQTPDTQDDVPKPRKRRAKKTLQRPGGVAVDTAPDSAPVKKKKKVSR", "length": 331, "header": "sp|A4L691-1|PINX1_RAT Isoform 1 of PIN2/TERF1-interacting telomerase inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Pinx1 PE=1 SV=1 CANONICAL=A4L691-1" }, "locus": { "chromosome": "15", "start_pos": 38156905, "end_pos": 38098027, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000016027.6", "url": "https://www.ensembl.org/id/ENSRNOT00000016027.6" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000016027.4", "url": "https://www.ensembl.org/id/ENSRNOP00000016027.4" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 233, "end_pos": 233, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "iPTMnet", "id": "A4L691", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A4L691" } ], "site_lbl": "Ser233" }, { "start_pos": 269, "end_pos": 269, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "site_lbl": "Ser269" }, { "start_pos": 274, "end_pos": 274, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "site_lbl": "Ser274" }, { "start_pos": 277, "end_pos": 277, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "site_lbl": "Ser277" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Rat homolog of PinX1 is a nucleolar protein involved in the regulation of telomere length.", "journal": "Gene", "date": "2007-10-01", "authors": "Oh Bong-Kyeong, Yoon So-Mi, Lee Chan-Hee, Park Young Nyun", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "reference": [ { "type": "PubMed", "id": "17624691", "url": "https://glygen.org/publication/PubMed/17624691" } ] }, { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nature communications", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" }, { "database": "iPTMnet", "id": "A4L691", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A4L691" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] }, { "title": "Regulation of PINX1 expression ameliorates lipopolysaccharide-induced lung injury and alleviates cell senescence during the convalescent phase through affecting the telomerase activity.", "journal": "Aging", "date": "2021", "authors": "Li S, Jiang B, Yu H, Song D", "evidence": [ { "database": "RefSeq", "id": "NP_001076806", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001076806" } ], "reference": [ { "type": "PubMed", "id": "33819185", "url": "https://glygen.org/publication/PubMed/33819185" } ] } ], "pathway": [ { "id": "rno:305963", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:305963", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A287AHL8-1", "protein_name": "PIN2/TERF1-interacting telomerase inhibitor 1 isoform 1", "gene_name": "PINX1", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MEAQDEVGRRKQKWAVDPRNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAALNTCHGQETADSSDNKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQKKKTPEETSSPATPEGTETTTTTSAFTIHEYFAKRMAERKNKLQDTAEGPGVSETPLQSKRGKKRKKEAKDKSVENGTQPKAKKKRARAEWQLGDPGRDENSGVSAEDREGSREVLSDQDFPLKPRRRKEKKKLPKPVEAAVAGMLEETPVKKKKKKKDSE", "length": 313 }, "evidence": [ { "id": "A4L691", "url": "https://omabrowser.org/oma/group/A4L691/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "Q54XG0-1", "protein_name": "Uncharacterized G-patch domain protein DDB_G0278987", "gene_name": "", "tax_id": 44689, "organism": "Dictyostelium discoideum", "sequence": { "sequence": "MSSDEGETPKMGFGHAMLLKMGWKGKGLGVEEDGRTEIIVNKKKQDKVGVGASISDRVSTSNNWESTNEAYDHILAKLNGVDEITWKKKNNKFVKEEKITFKRTIKKNSKKNKDESDSDSDSDSESESDKKPTKKQKVQSDSDSSCSDSSSSSSSSSSESEKEDKSSSNTTSDESDKESSSDSSDSSESENEKKDKKKIVNNKKGKDSDSSSSSDDSCSSESDSSSSSSSSSSSSDSSSESDSDNKNKNKNKNKNKKSKESDSSSSSSSSESEEEEKKEVAKKSFSVSKTRYQRLLRAKSVKNYSEDDLREILGYRPNQDTRKLKTKE", "length": 328 }, "evidence": [ { "id": "A4L691", "url": "https://omabrowser.org/oma/group/A4L691/", "database": "OMA" } ], "glygen_name": "Cellular slime mold", "common_name": "Social amoeba" }, { "uniprot_canonical_ac": "Q96BK5-1", "protein_name": "PIN2/TERF1-interacting telomerase inhibitor 1", "gene_name": "PINX1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERKRGKKRNKEATGKDVESYLQPKAKRHTEGKPERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDHVQPPEGRDFTLKPKKRRGKKKLQKPVEIAEDATLEETLVKKKKKKDSK", "length": 328 }, "evidence": [ { "id": "46360689", "url": "http://www.informatics.jax.org/homology/46360689", "database": "MGI" }, { "id": "A4L691", "url": "https://omabrowser.org/oma/group/A4L691/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q9CZX5-1", "protein_name": "PIN2/TERF1-interacting telomerase inhibitor 1", "gene_name": "Pinx1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSMLAERRRKQKWTVDPRNTAWSNDDSKFGQKMLEKMGWSKGKGLGAQEQGATEHIKVKVKNNHLGLGATNNNEDNWIAHQDDFNQLLAALNTCHGQETADSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSETDLDCIFGKRRNKKLAQDGCSNSSADEVNTSLTTTTTTTSAFTIQEYFAKRMAQLKNKPQASAPGSDLSETPVERKKGKKKNKEAADTDVENSPQHKAKRHKKKKRVEAERGPVAKKRDRAELQPGGPSEDECSDASVEAAEDCVQTPDIQDDVPKPKKRKAKKKLQRPEGVEIDATLDRAPVKKKKKKVSR", "length": 332 }, "evidence": [ { "id": "46360689", "url": "http://www.informatics.jax.org/homology/46360689", "database": "MGI" }, { "id": "A4L691", "url": "https://omabrowser.org/oma/group/A4L691/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 9, "go_terms": [ { "name": "protein localization to nucleolus", "id": "GO:1902570", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902570", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "pmid": "" }, { "name": "negative regulation of telomere maintenance via telomerase", "id": "GO:0032211", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032211", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "pmid": "" }, { "name": "protein localization to chromosome, telomeric region", "id": "GO:0070198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070198", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "pmid": "" }, { "name": "regulation of protein stability", "id": "GO:0031647", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031647", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "pmid": "" }, { "name": "negative regulation of protein ubiquitination", "id": "GO:0031397", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031397", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "pmid": "" }, { "name": "mitotic metaphase chromosome alignment", "id": "GO:0007080", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007080", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "pmid": "" }, { "name": "negative regulation of G2/M transition of mitotic cell cycle", "id": "GO:0010972", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010972", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "pmid": "" }, { "name": "telomere maintenance via telomerase", "id": "GO:0007004", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007004", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "pmid": "" }, { "name": "positive regulation of protein localization to nucleolus", "id": "GO:1904751", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904751", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "pmid": "" }, { "name": "spindle", "id": "GO:0005819", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005819", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "pmid": "" }, { "name": "kinetochore", "id": "GO:0000776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000776", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "pmid": "" }, { "name": "nuclear chromosome", "id": "GO:0000228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000228", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "pmid": "" }, { "name": "chromosome, telomeric region", "id": "GO:0000781", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000781", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "pmid": "" }, { "name": "telomerase RNA binding", "id": "GO:0070034", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070034", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "pmid": "" }, { "name": "telomerase inhibitor activity", "id": "GO:0010521", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010521", "evidence": [ { "database": "UniProtKB", "id": "A4L691", "url": "https://www.uniprot.org/uniprot/A4L691" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 162, "end_pos": 164, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 233, 269, 274, 277 ], "sequon_annotation_sites": [ { "start_pos": 162, "end_pos": 164 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }