{ "uniprot_canonical_ac": "A2TF48-1", "uniprot_ac": "A2TF48", "uniprot_id": "MYD88_PIG", "mass": { "chemical_mass": 33254.0, "monoisotopic_mass": 33254.0 }, "refseq": { "ac": "NP_001093393", "name": "myeloid differentiation primary response protein MyD88", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093393" }, "gene_names": [ { "name": "MYD88", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2TF48", "id": "A2TF48" }, { "name": "MYD88", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093393", "id": "NP_001093393" } ], "protein_names": [ { "name": "Myeloid differentiation primary response protein MyD88", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A2TF48/entry#names_and_taxonomy", "id": "A2TF48" }, { "name": "myeloid differentiation primary response gene (88); myeloid differentiation primary response 88", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093393", "id": "NP_001093393" }, { "name": "myeloid differentiation primary response protein MyD88", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093393", "id": "NP_001093393" } ], "function": [ { "annotation": "Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response. Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway. Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes. Upon TLR8 activation by GU-rich single-stranded RNA (GU-rich RNA) derived from viruses, induces IL1B release through NLRP3 inflammasome activation (By similarity). MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the expression of the antimicrobial lectin REG3G in the small intestine (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48#function" }, { "database": "UniProtKB", "id": "Q99836", "url": "https://www.uniprot.org/uniprot/Q99836#function" }, { "database": "UniProtKB", "id": "P22366", "url": "https://www.uniprot.org/uniprot/P22366#function" } ] }, { "annotation": "At 30 days after autotransplantation of a pig kidney, mRNA expression increases for MyD88.", "evidence": [ { "database": "RefSeq", "id": "NP_001093393", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093393" }, { "database": "PubMed", "id": "25380861", "url": "https://glygen.org/publication/PubMed/25380861" } ] }, { "annotation": "These results suggest that an MyD88-dependent signaling pathway is present in newborn as well as in adult swine and that it is involved in the innate immune system of these animals.", "evidence": [ { "database": "RefSeq", "id": "NP_001093393", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093393" }, { "database": "PubMed", "id": "17976317", "url": "https://glygen.org/publication/PubMed/17976317" } ] }, { "annotation": "These results suggest that porcine circovirus 2 induces IL-8 secretion via the TLR2/MyD88/NF-kappaB signalling pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_001093393", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093393" }, { "database": "PubMed", "id": "26581603", "url": "https://glygen.org/publication/PubMed/26581603" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Sus scrofa", "taxid": 9823, "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" } ], "gene": [ { "name": "MYD88", "url": "https://www.uniprot.org/uniprot/A2TF48", "locus": { "chromosome": "13", "start_pos": 22983109, "end_pos": 22966137, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSSSCG00000011251", "url": "https://www.ensembl.org/id/ENSSSCG00000011251" } ] } } ], "crossref": [ { "id": "cd08312", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08312", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "396646", "url": "https://www.ncbi.nlm.nih.gov/gene/396646", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000157", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000157", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000488", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000488", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011029", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011029", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017281", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017281", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034249", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034249", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035897", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035897", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ssc:396646", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ssc:396646", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2964088at2759", "url": "http://www.orthodb.org/?query=2964088at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15079", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15079", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15079:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15079:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00531", "url": "http://pfam.xfam.org/family/PF00531", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13676", "url": "http://pfam.xfam.org/family/PF13676", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001093393", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093393", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2TF48-1", "url": "https://www.uniprot.org/uniprot/A2TF48-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAGGSGAESAPPTPSMSSLPLAALNVRVRHRLSLFLNVRTQVAADWTGLAEEMNFEYLEIRRLETHPDPTRSLLDDWQGRPGASVGRLLELLAKLGRDDVLVELGPSIEEDCRKYILKQQQEAAEKPLQVDSVDSSIPWMSGITIRDDPLGQMPEHFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPVKYKSMKKEFPSILRFITVCDYTNPCTKSWFWTRLARALSLP", "length": 293, "header": "sp|A2TF48-1|MYD88_PIG Isoform 1 of Myeloid differentiation primary response protein MyD88 OS=Sus scrofa OX=9823 GN=MYD88 PE=2 SV=2 CANONICAL=A2TF48-1" }, "isoforms": [ { "isoform_ac": "A2TF48-1", "url": "https://www.uniprot.org/uniprotkb/A2TF48/entry#A2TF48-1", "sequence": { "sequence": "MAAGGSGAESAPPTPSMSSLPLAALNVRVRHRLSLFLNVRTQVAADWTGLAEEMNFEYLEIRRLETHPDPTRSLLDDWQGRPGASVGRLLELLAKLGRDDVLVELGPSIEEDCRKYILKQQQEAAEKPLQVDSVDSSIPWMSGITIRDDPLGQMPEHFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPVKYKSMKKEFPSILRFITVCDYTNPCTKSWFWTRLARALSLP", "length": 293, "header": "sp|A2TF48-1|MYD88_PIG Isoform 1 of Myeloid differentiation primary response protein MyD88 OS=Sus scrofa OX=9823 GN=MYD88 PE=2 SV=2 CANONICAL=A2TF48-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 241, "end_pos": 241, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" } ], "site_lbl": "Ser241" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Toll-like receptor 7 and MyD88 knockdown by lentivirus-mediated RNA interference to porcine dendritic cell subsets.", "journal": "Gene Ther.", "date": "2007", "authors": "Alves M P, Neuhaus V, Guzylack-Piriou L, Ruggli N, McCullough K C, Summerfield A", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" } ], "reference": [ { "type": "PubMed", "id": "17330086", "url": "https://glygen.org/publication/PubMed/17330086" } ] }, { "title": "Molecular cloning and functional characterization of porcine MyD88 essential for TLR signaling.", "journal": "Cell. Mol. Immunol.", "date": "2007", "authors": "Tohno Masanori, Shimazu Tomoyuki, Aso Hisashi, Kawai Yasushi, Saito Tadao, Kitazawa Haruki", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" }, { "database": "RefSeq", "id": "NP_001093393", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093393" } ], "reference": [ { "type": "PubMed", "id": "17976317", "url": "https://glygen.org/publication/PubMed/17976317" } ] }, { "title": "Toll-like receptors 2 and 4 in pigs' kidneys early after autotransplantation procedure.", "journal": "Transplantation proceedings", "date": "2014-10", "authors": "Caban A, Oczkowicz G, Budzi\u0144ski G, Suszka-\u015awitek A, Doli\u0144ska B, Ostr\u00f3\u017cka-Cie\u015blik A, Wieczorek J, Ryszka F, Wiaderkiewicz R, Cierpka L", "evidence": [ { "database": "RefSeq", "id": "NP_001093393", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093393" } ], "reference": [ { "type": "PubMed", "id": "25380861", "url": "https://glygen.org/publication/PubMed/25380861" } ] }, { "title": "TLR2/MyD88/NF-\u03baB signalling pathway regulates IL-8 production in porcine alveolar macrophages infected with porcine circovirus 2.", "journal": "The Journal of general virology", "date": "2016-02", "authors": "Qin Yao, Li Haihua, Qiao Jiayun", "evidence": [ { "database": "RefSeq", "id": "NP_001093393", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093393" } ], "reference": [ { "type": "PubMed", "id": "26581603", "url": "https://glygen.org/publication/PubMed/26581603" } ] } ], "pathway": [ { "id": "ssc:396646", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ssc:396646", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" } ], "pmid": "" }, { "name": "defense response to Gram-positive bacterium", "id": "GO:0050830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050830", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" } ], "pmid": "" }, { "name": "defense response to virus", "id": "GO:0051607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051607", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" } ], "pmid": "" }, { "name": "positive regulation of canonical NF-kappaB signal transduction", "id": "GO:0043123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043123", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" } ], "pmid": "" }, { "name": "positive regulation of interleukin-1 beta production", "id": "GO:0032731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032731", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" } ], "pmid": "" }, { "name": "Toll signaling pathway", "id": "GO:0008063", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008063", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" } ], "pmid": "" }, { "name": "toll-like receptor 4 signaling pathway", "id": "GO:0034142", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034142", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" } ], "pmid": "" }, { "name": "positive regulation of NLRP3 inflammasome complex assembly", "id": "GO:1900227", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900227", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" } ], "pmid": "" }, { "name": "MyD88-dependent toll-like receptor signaling pathway", "id": "GO:0002755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002755", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" } ], "pmid": "" }, { "name": "toll-like receptor 8 signaling pathway", "id": "GO:0034158", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034158", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "Toll-like receptor binding", "id": "GO:0035325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035325", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" } ], "pmid": "" }, { "name": "TIR domain binding", "id": "GO:0070976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070976", "evidence": [ { "database": "UniProtKB", "id": "A2TF48", "url": "https://www.uniprot.org/uniprot/A2TF48" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 241 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }