{ "uniprot_canonical_ac": "A2BDG0-1", "uniprot_ac": "A2BDG0", "uniprot_id": "SPRN_CHICK", "mass": { "chemical_mass": 12126.0, "monoisotopic_mass": 12126.0 }, "refseq": {}, "gene_names": [ { "name": "SPRN", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2BDG0", "id": "A2BDG0" } ], "protein_names": [ { "name": "Shadow of prion protein", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A2BDG0/entry#names_and_taxonomy", "id": "A2BDG0" }, { "name": "Protein shadoo", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A2BDG0/entry#names_and_taxonomy", "id": "A2BDG0" } ], "function": [ { "annotation": "Prion-like protein that has PrP(C)-like neuroprotective activity.", "evidence": [ { "database": "UniProtKB", "id": "A2BDG0", "url": "https://www.uniprot.org/uniprot/A2BDG0#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A2BDG0", "url": "https://www.uniprot.org/uniprot/A2BDG0" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "SPRN", "url": "https://www.uniprot.org/uniprot/A2BDG0", "locus": {} } ], "crossref": [ { "id": "ENSGALG00000029823", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000029823", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR029238", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029238", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR28552", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28552", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR28552:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28552:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF14999", "url": "http://pfam.xfam.org/family/PF14999", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A2BDG0", "url": "http://purl.obolibrary.org/obo/PR_A2BDG0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-GGA-163125", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-163125", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "A2BDG0", "url": "https://www.uniprot.org/uniprot/A2BDG0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2BDG0-1", "url": "https://www.uniprot.org/uniprot/A2BDG0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRQRVACCWVLLLLAATFCQPAAAKGGRGGSRGAARGMARGAARSRHRGLPRYGGALRVAAAAAAAGAAAGAALHQARAETEYHEGNGTAWTSVAPGWVEWGWAMPWLCPLAAILHH", "length": 117, "header": "sp|A2BDG0-1|SPRN_CHICK Isoform 1 of Shadow of prion protein OS=Gallus gallus OX=9031 GN=SPRN PE=3 SV=1 CANONICAL=A2BDG0-1" }, "isoforms": [ { "isoform_ac": "A2BDG0-1", "url": "https://www.uniprot.org/uniprotkb/A2BDG0/entry#A2BDG0-1", "sequence": { "sequence": "MRQRVACCWVLLLLAATFCQPAAAKGGRGGSRGAARGMARGAARSRHRGLPRYGGALRVAAAAAAAGAAAGAALHQARAETEYHEGNGTAWTSVAPGWVEWGWAMPWLCPLAAILHH", "length": 117, "header": "sp|A2BDG0-1|SPRN_CHICK Isoform 1 of Shadow of prion protein OS=Gallus gallus OX=9031 GN=SPRN PE=3 SV=1 CANONICAL=A2BDG0-1" }, "locus": { "chromosome": "6", "start_pos": 10095052, "end_pos": 10094702, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010056763.1", "url": "https://www.ensembl.org/id/ENSGALT00010056763.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010034505.1", "url": "https://www.ensembl.org/id/ENSGALP00010034505.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 87, "start_aa": "Asn", "end_pos": 87, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn87", "evidence": [ { "id": "A2BDG0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2BDG0#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Transcriptome analysis for the chicken based on 19,626 finished cDNA sequences and 485,337 expressed sequence tags.", "journal": "Genome Res.", "date": "2005", "authors": "Hubbard Simon J, Grafham Darren V, Beattie Kevin J, Overton Ian M, McLaren Stuart R, Croning Michael D R, Boardman Paul E, Bonfield James K, Burnside Joan, Davies Robert M, Farrell Elizabeth R, Francis Matthew D, Griffiths-Jones Sam, Humphray Sean J, Hyland Christopher, Scott Carol E, Tang Haizhou, Taylor Ruth G, Tickle Cheryll, Brown William R A, Birney Ewan, Rogers Jane, Wilson Stuart A", "evidence": [ { "database": "UniProtKB", "id": "A2BDG0", "url": "https://www.uniprot.org/uniprot/A2BDG0" } ], "reference": [ { "type": "PubMed", "id": "15590942", "url": "https://glygen.org/publication/PubMed/15590942" } ] }, { "title": "Comparative genomic analysis of prion genes.", "journal": "BMC Genomics", "date": "2007", "authors": "Premzl M, Gamulin V", "evidence": [ { "database": "UniProtKB", "id": "A2BDG0", "url": "https://www.uniprot.org/uniprot/A2BDG0" } ], "reference": [ { "type": "PubMed", "id": "17199895", "url": "https://glygen.org/publication/PubMed/17199895" } ] } ], "pathway": [ { "id": "R-GGA-163125", "name": "Post-translational modification: synthesis of GPI-anchored proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-163125", "resource": "Reactome", "description": "Post-translational modification: synthesis of GPI-anchored proteins" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A2BDG0", "url": "https://www.uniprot.org/uniprot/A2BDG0" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A2BDG0", "url": "https://www.uniprot.org/uniprot/A2BDG0" } ], "pmid": "" }, { "name": "side of membrane", "id": "GO:0098552", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098552", "evidence": [ { "database": "UniProtKB", "id": "A2BDG0", "url": "https://www.uniprot.org/uniprot/A2BDG0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "nucleic acid binding", "id": "GO:0003676", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003676", "evidence": [ { "database": "UniProtKB", "id": "A2BDG0", "url": "https://www.uniprot.org/uniprot/A2BDG0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "protein import into nucleus", "id": "GO:0006606", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006606", "evidence": [ { "database": "UniProtKB", "id": "A2BDG0", "url": "https://www.uniprot.org/uniprot/A2BDG0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 87, "end_pos": 89, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [ 87 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 87, "end_pos": 89 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }