{ "uniprot_canonical_ac": "A2BD05-1", "uniprot_ac": "A2BD05", "uniprot_id": "NEK6_PIG", "mass": { "chemical_mass": 35715.0, "monoisotopic_mass": 35715.0 }, "refseq": { "ac": "XP_003122211", "name": "serine/threonine-protein kinase Nek6", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003122211" }, "gene_names": [ { "name": "NEK6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2BD05", "id": "A2BD05" }, { "name": "NEK6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003122211", "id": "XP_003122211" } ], "protein_names": [ { "name": "Serine/threonine-protein kinase Nek6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A2BD05/entry#names_and_taxonomy", "id": "A2BD05" }, { "name": "2.7.11.34", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A2BD05/entry#names_and_taxonomy", "id": "A2BD05" }, { "name": "Never in mitosis A-related kinase 6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A2BD05/entry#names_and_taxonomy", "id": "A2BD05" }, { "name": "NimA-related protein kinase 6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A2BD05/entry#names_and_taxonomy", "id": "A2BD05" }, { "name": "serine/threonine-protein kinase Nek6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003122211", "id": "XP_003122211" } ], "function": [ { "annotation": "Protein kinase which plays an important role in mitotic cell cycle progression. Required for chromosome segregation at metaphase-anaphase transition, robust mitotic spindle formation and cytokinesis. Phosphorylates ATF4, CIR1, PTN, RAD26L, RBBP6, RPS7, RPS6KB1, TRIP4, STAT3 and histones H1 and H3. Phosphorylates KIF11 to promote mitotic spindle formation. Involved in G2/M phase cell cycle arrest induced by DNA damage. Inhibition of activity results in apoptosis. May contribute to tumorigenesis by suppressing p53/TP53-induced cancer cell senescence (By similarity). Phosphorylates EML4 at 'Ser-144', promoting its dissociation from microtubules during mitosis which is required for efficient chromosome congression (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05#function" }, { "database": "UniProtKB", "id": "Q9HC98", "url": "https://www.uniprot.org/uniprot/Q9HC98#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Sus scrofa", "taxid": 9823, "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" } ], "gene": [ { "name": "NEK6", "url": "https://www.uniprot.org/uniprot/A2BD05", "locus": { "chromosome": "1", "start_pos": 265176903, "end_pos": 265078435, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSSSCG00000005587", "url": "https://www.ensembl.org/id/ENSSSCG00000005587" } ] } } ], "crossref": [ { "id": "ENSSSCG00000005587", "url": "https://bgee.org/?page=gene&gene_id=ENSSSCG00000005587", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd08228", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08228", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "100514624", "url": "https://www.ncbi.nlm.nih.gov/gene/100514624", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000719", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000719", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001245", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001245", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008271", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008271", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011009", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011009", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017441", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017441", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ssc:100514624", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ssc:100514624", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "198307at2759", "url": "http://www.orthodb.org/?query=198307at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43289", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43289", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43289:SF13", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43289:SF13", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00069", "url": "http://pfam.xfam.org/family/PF00069", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-2980767", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-2980767", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-3301854", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-3301854", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-9648025", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-9648025", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_003122211", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003122211", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "17989", "url": "https://www.rhea-db.org/rhea/17989", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "46608", "url": "https://www.rhea-db.org/rhea/46608", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2BD05-1", "url": "https://www.uniprot.org/uniprot/A2BD05-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAGQPSHMPHGGSPNNLCHTPGPAHPPDPQRHPNALSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPNQRPDIGYVHQVARQMHVWTSST", "length": 313, "header": "sp|A2BD05-1|NEK6_PIG Isoform 1 of Serine/threonine-protein kinase Nek6 OS=Sus scrofa OX=9823 GN=NEK6 PE=3 SV=1 CANONICAL=A2BD05-1" }, "isoforms": [ { "isoform_ac": "A2BD05-1", "url": "https://www.uniprot.org/uniprotkb/A2BD05/entry#A2BD05-1", "sequence": { "sequence": "MAGQPSHMPHGGSPNNLCHTPGPAHPPDPQRHPNALSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPNQRPDIGYVHQVARQMHVWTSST", "length": 313, "header": "sp|A2BD05-1|NEK6_PIG Isoform 1 of Serine/threonine-protein kinase Nek6 OS=Sus scrofa OX=9823 GN=NEK6 PE=3 SV=1 CANONICAL=A2BD05-1" }, "locus": { "chromosome": "LUXV01102365.1", "start_pos": 842987, "end_pos": 799163, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSSSCT00050059114.1", "url": "https://www.ensembl.org/id/ENSSSCT00050059114.1" }, { "database": "Ensembl Peptide", "id": "ENSSSCP00050025370.1", "url": "https://www.ensembl.org/id/ENSSSCP00050025370.1" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 202, "end_pos": 202, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "site_lbl": "Thr202" }, { "start_pos": 206, "end_pos": 206, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by NEK9", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "site_lbl": "Ser206" }, { "start_pos": 210, "end_pos": 210, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "site_lbl": "Thr210" }, { "start_pos": 37, "end_pos": 37, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "site_lbl": "Ser37" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Fine mapping of a swine quantitative trait locus for number of vertebrae and analysis of an orphan nuclear receptor, germ cell nuclear factor (NR6A1).", "journal": "Genome Res.", "date": "2007", "authors": "Mikawa Satoshi, Morozumi Takeya, Shimanuki Shin-Ichi, Hayashi Takeshi, Uenishi Hirohide, Domukai Michiko, Okumura Naohiko, Awata Takashi", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "reference": [ { "type": "PubMed", "id": "17416745", "url": "https://glygen.org/publication/PubMed/17416745" } ] } ], "pathway": [ { "id": "ssc:100514624", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ssc:100514624", "resource": "KEGG Pathway" }, { "id": "R-SSC-2980767", "name": "Activation of NIMA Kinases NEK9, NEK6, NEK7", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-2980767", "resource": "Reactome", "description": "Activation of NIMA Kinases NEK9, NEK6, NEK7" }, { "id": "R-SSC-3301854", "name": "Nuclear Pore Complex (NPC) Disassembly", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-3301854", "resource": "Reactome", "description": "Nuclear Pore Complex (NPC) Disassembly" }, { "id": "R-SSC-9648025", "name": "EML4 and NUDC in mitotic spindle formation", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-9648025", "resource": "Reactome", "description": "EML4 and NUDC in mitotic spindle formation" } ], "orthologs": [ { "uniprot_canonical_ac": "P59895-1", "protein_name": "Serine/threonine-protein kinase Nek6", "gene_name": "Nek6", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAGQPSHMPHGGSPNHLCHVLGPAHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPNHRPDIEYVHQVAKQMHVWTSST", "length": 313 }, "evidence": [ { "id": "A2BD05", "url": "https://omabrowser.org/oma/group/A2BD05/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9ES70-1", "protein_name": "Serine/threonine-protein kinase Nek6", "gene_name": "Nek6", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAGQPSHMPHGGSPNHLCHALGPAPPPDPQRLPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPDHRPDIVYVHQVARQMHVWTSST", "length": 313 }, "evidence": [ { "id": "A2BD05", "url": "https://omabrowser.org/oma/group/A2BD05/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 9, "go_terms": [ { "name": "magnesium ion binding", "id": "GO:0000287", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000287", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" }, { "name": "protein serine/threonine kinase activity", "id": "GO:0004674", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004674", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" }, { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" }, { "name": "ubiquitin protein ligase binding", "id": "GO:0031625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031625", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" }, { "name": "kinesin binding", "id": "GO:0019894", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019894", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" }, { "name": "transcription corepressor binding", "id": "GO:0001222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001222", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" }, { "name": "DNA-binding transcription factor binding", "id": "GO:0140297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140297", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" }, { "name": "protein serine kinase activity", "id": "GO:0106310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106310", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "spindle pole", "id": "GO:0000922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000922", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" }, { "name": "nuclear speck", "id": "GO:0016607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016607", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" }, { "name": "centriolar satellite", "id": "GO:0034451", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034451", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "protein phosphorylation", "id": "GO:0006468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006468", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" }, { "name": "chromosome segregation", "id": "GO:0007059", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007059", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" }, { "name": "cell division", "id": "GO:0051301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" }, { "name": "apoptotic process", "id": "GO:0006915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006915", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" }, { "name": "protein autophosphorylation", "id": "GO:0046777", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046777", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" }, { "name": "regulation of mitotic metaphase/anaphase transition", "id": "GO:0030071", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030071", "evidence": [ { "database": "UniProtKB", "id": "A2BD05", "url": "https://www.uniprot.org/uniprot/A2BD05" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "17989", "name": "", "equation": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "17989", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/17989" } ] }, { "id": "46608", "name": "", "equation": "ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "46608", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/46608" } ] }, { "id": "R-SSC-2980720", "name": "NEK9 binds NEK6/NEK7 in the cytosol", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-2980720", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-2980720" } ] }, { "id": "R-SSC-2984258", "name": "NEK9 phosphorylates NEK6/NEK7", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-2984258", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-2984258" } ] }, { "id": "R-SSC-2990880", "name": "NEK6/NEK7 phosphorylates NUP98", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, nuclear envelope, nucleoplasm", "input_participant_list": [], "output_participant_list": [ "R-SSC-2990884", "R-SSC-2990915" ], "enzyme_list": [], "evidence": [ { "id": "R-SSC-2990880", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-2990880" } ] }, { "id": "R-SSC-9648017", "name": "EML4 binds to microtubules", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-9648017", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-9648017" } ] }, { "id": "R-SSC-9648089", "name": "NEK6 and NEK7 phosphorylate EML4", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-9648089", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-9648089" } ] } ], "reaction_participants": [ { "participant_id": "R-SSC-2990884", "participant_name": "phospho-NUP98 [nucleoplasm]", "crossref": [ { "id": "ENSSSCP00000015713", "database": "Ensembl", "url": "" }, { "id": "ENSSSCT00000016145", "database": "Ensembl", "url": "" }, { "id": "F1SUZ2", "database": "UniProt", "url": "" }, { "id": "90988", "database": "VGNC", "url": "" }, { "id": "ENSG00000110713", "database": "OpenTargets", "url": "" }, { "id": "ENSSSCG00000014794", "database": "Ensembl", "url": "" } ] }, { "participant_id": "R-SSC-2990915", "participant_name": "phospho-NUP98 [cytosol]", "crossref": [ { "id": "ENSSSCT00000016145", "database": "Ensembl", "url": "" }, { "id": "F1SUZ2", "database": "UniProt", "url": "" }, { "id": "ENSSSCP00000015713", "database": "Ensembl", "url": "" }, { "id": "ENSG00000110713", "database": "OpenTargets", "url": "" }, { "id": "ENSSSCG00000014794", "database": "Ensembl", "url": "" }, { "id": "90988", "database": "VGNC", "url": "" } ] } ], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 37, 202, 206, 210 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }