{ "uniprot_canonical_ac": "A2AE20-1", "uniprot_ac": "A2AE20", "uniprot_id": "LYZL5_MOUSE", "mass": { "chemical_mass": 18005.0, "monoisotopic_mass": 18005.0 }, "refseq": { "ac": "NP_001078862", "name": "sperm acrosome-associated protein 5 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078862" }, "gene_names": [ { "name": "Spaca5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2AE20", "id": "A2AE20" }, { "name": "Gm718; Lyze", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078862", "id": "NP_001078862" }, { "name": "Gm718", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2AE20", "id": "A2AE20" }, { "name": "Lyzl5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2AE20", "id": "A2AE20" }, { "name": "Spaca5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078862", "id": "NP_001078862" } ], "protein_names": [ { "name": "Sperm acrosome-associated protein 5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A2AE20/entry#names_and_taxonomy", "id": "A2AE20" }, { "name": "3.2.1.17", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A2AE20/entry#names_and_taxonomy", "id": "A2AE20" }, { "name": "Lysozyme-like protein 5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A2AE20/entry#names_and_taxonomy", "id": "A2AE20" }, { "name": "sperm acrosome-associated protein 5 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078862", "id": "NP_001078862" }, { "name": "sperm acrosome-associated protein 5; novel C-type lysozyme/alpha-lactalbumin family domain containing protein; lysozyme-like protein 5; lysozyme e", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078862", "id": "NP_001078862" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A2AE20", "url": "https://www.uniprot.org/uniprot/A2AE20" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "gene": [ { "name": "Spaca5", "url": "https://www.uniprot.org/uniprot/A2AE20", "locus": { "chromosome": "X", "start_pos": 20944202, "end_pos": 20934645, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000037167", "url": "https://www.ensembl.org/id/ENSMUSG00000037167" } ] } } ], "crossref": [ { "id": "ENSMUSG00000037167", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000037167", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "GH22", "url": "http://www.cazy.org/GH22.html", "database": "CAZy", "categories": [ "Protein Classification" ] }, { "id": "cd16897", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16897", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "278203", "url": "https://www.ncbi.nlm.nih.gov/gene/278203", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000974", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000974", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001916", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001916", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023346", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023346", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:278203", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:278203", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2685564", "url": "http://www.informatics.jax.org/marker/MGI:2685564", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "SAWWCNN", "url": "https://omabrowser.org/oma/group/SAWWCNN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5344399at2759", "url": "http://www.orthodb.org/?query=5344399at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11407", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11407", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11407:SF31", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11407:SF31", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00062", "url": "http://pfam.xfam.org/family/PF00062", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A2AE20", "url": "http://purl.obolibrary.org/obo/PR_A2AE20", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001078862", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078862", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A2AE20", "url": "https://www.uniprot.org/uniprot/A2AE20", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2AE20-1", "url": "https://www.uniprot.org/uniprot/A2AE20-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKVCSIVVVILAVLLIAKLDAKIYERCELAKKLEEAGLDGFKGYTVGDWLCVAHYESGFDTSFVDHNPDGSSEYGIFQLNSAWWCNNGITPTQNLCNIDCNDLLNRHILDDIICAKRVASSHKSMKAWDSWTQHCAGHDLSEWLKGCSVRLKTDSSYNNW", "length": 160, "header": "sp|A2AE20-1|LYZL5_MOUSE Isoform 1 of Sperm acrosome-associated protein 5 OS=Mus musculus OX=10090 GN=Spaca5 PE=1 SV=1 CANONICAL=A2AE20-1" }, "isoforms": [ { "isoform_ac": "A2AE20-1", "url": "https://www.uniprot.org/uniprotkb/A2AE20/entry#A2AE20-1", "sequence": { "sequence": "MKVCSIVVVILAVLLIAKLDAKIYERCELAKKLEEAGLDGFKGYTVGDWLCVAHYESGFDTSFVDHNPDGSSEYGIFQLNSAWWCNNGITPTQNLCNIDCNDLLNRHILDDIICAKRVASSHKSMKAWDSWTQHCAGHDLSEWLKGCSVRLKTDSSYNNW", "length": 160, "header": "sp|A2AE20-1|LYZL5_MOUSE Isoform 1 of Sperm acrosome-associated protein 5 OS=Mus musculus OX=10090 GN=Spaca5 PE=1 SV=1 CANONICAL=A2AE20-1" }, "locus": { "chromosome": "X", "start_pos": 20944124, "end_pos": 20934727, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000040437.6", "url": "https://www.ensembl.org/id/ENSMUST00000040437.6" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000048721.6", "url": "https://www.ensembl.org/id/ENSMUSP00000048721.6" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycohydrolase-activity" ], "publication": [], "pathway": [ { "id": "mmu:278203", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:278203", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D5K891-1", "protein_name": "Sperm acrosome associated 5", "gene_name": "SPACA5", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MKAWGSVVVTLTMLMAATVDAKIYERCELATKLEKAGLDGFKGYTTGDWLCMAHYESGFDTSFVNHNPDGSSEYGIFQLNSAWWCDNGVTPTQNLCHMECHELLNRHILDDIMCAQQVVSSQEGMNAWDSWSQHCSGHDLSEWLKGCHLNVKPDPKRIHS", "length": 160 }, "evidence": [ { "id": "A2AE20", "url": "https://omabrowser.org/oma/group/A2AE20/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "M0RCC1-1", "protein_name": "Sperm acrosome associated 5", "gene_name": "Spaca5", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MQFCSTVVVILATLLLATVDAKIYERCELARKLEKAGLNGFKGYTVGDWLCVAHYESGFDTSFVDHNPDGSSEYGIFQLNSAWWCNNGITPTQNLCHMDCNDLLNRHILDDIMCAKRVVSSHKSMKAWDSWTRHCAGHDLSEWLKGCDVPLKADSNYDDW", "length": 160 }, "evidence": [ { "id": "46358320", "url": "http://www.informatics.jax.org/homology/46358320", "database": "MGI" }, { "id": "A2AE20", "url": "https://omabrowser.org/oma/group/A2AE20/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q96QH8-1", "protein_name": "Sperm acrosome-associated protein 5", "gene_name": "SPACA5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKAWGTVVVTLATLMVVTVDAKIYERCELAARLERAGLNGYKGYGVGDWLCMAHYESGFDTAFVDHNPDGSSEYGIFQLNSAWWCDNGITPTKNLCHMDCHDLLNRHILDDIRCAKQIVSSQNGLSAWTSWRLHCSGHDLSEWLKGCDMHVKIDPKIHP", "length": 159 }, "evidence": [ { "id": "46358320", "url": "http://www.informatics.jax.org/homology/46358320", "database": "MGI" }, { "id": "A2AE20", "url": "https://omabrowser.org/oma/group/A2AE20/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A2AE20", "url": "https://www.uniprot.org/uniprot/A2AE20" } ], "pmid": "" }, { "name": "acrosomal vesicle", "id": "GO:0001669", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001669", "evidence": [ { "database": "UniProtKB", "id": "A2AE20", "url": "https://www.uniprot.org/uniprot/A2AE20" } ], "pmid": "" }, { "name": "sperm flagellum", "id": "GO:0036126", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036126", "evidence": [ { "database": "UniProtKB", "id": "A2AE20", "url": "https://www.uniprot.org/uniprot/A2AE20" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "fusion of sperm to egg plasma membrane involved in single fertilization", "id": "GO:0007342", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007342", "evidence": [ { "database": "UniProtKB", "id": "A2AE20", "url": "https://www.uniprot.org/uniprot/A2AE20" } ], "pmid": "" }, { "name": "metabolic process", "id": "GO:0008152", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008152", "evidence": [ { "database": "UniProtKB", "id": "A2AE20", "url": "https://www.uniprot.org/uniprot/A2AE20" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "lysozyme activity", "id": "GO:0003796", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003796", "evidence": [ { "database": "UniProtKB", "id": "A2AE20", "url": "https://www.uniprot.org/uniprot/A2AE20" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "3.2.1.17", "ec_name": "Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.", "evidence": [ { "id": "3.2.1.17", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.2.1.17" } ] } ], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }