{ "uniprot_canonical_ac": "A2A7V7-1", "uniprot_ac": "A2A7V7", "uniprot_id": "CLM6_MOUSE", "mass": { "chemical_mass": 25336.0, "monoisotopic_mass": 25336.0 }, "refseq": {}, "gene_names": [ { "name": "Cd300c", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2A7V7", "id": "A2A7V7" }, { "name": "Clm6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2A7V7", "id": "A2A7V7" } ], "protein_names": [ { "name": "CMRF35-like molecule 6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A2A7V7/entry#names_and_taxonomy", "id": "A2A7V7" }, { "name": "CD300 antigen-like family member C", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A2A7V7/entry#names_and_taxonomy", "id": "A2A7V7" }, { "name": "CLM-6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A2A7V7/entry#names_and_taxonomy", "id": "A2A7V7" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A2A7V7", "url": "https://www.uniprot.org/uniprot/A2A7V7" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "gene": [ { "name": "Cd300c", "url": "https://www.uniprot.org/uniprot/A2A7V7", "locus": { "chromosome": "11", "start_pos": 114846942, "end_pos": 114859983, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000058728", "url": "https://www.ensembl.org/id/ENSMUSG00000058728" } ] } } ], "crossref": [ { "id": "ENSMUSG00000058728", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000058728", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd05716", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05716", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "3032626", "url": "http://www.informatics.jax.org/marker/MGI:3032626", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "3031152at2759", "url": "http://www.orthodb.org/?query=3031152at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11860", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11860", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11860:SF116", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11860:SF116", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "http://pfam.xfam.org/family/PF07686", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A2A7V7", "url": "http://purl.obolibrary.org/obo/PR_A2A7V7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-198933", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_954695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_954695", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A2A7V7", "url": "https://www.uniprot.org/uniprot/A2A7V7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2A7V7-1", "url": "https://www.uniprot.org/uniprot/A2A7V7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z6G7", "url": "https://www.uniprot.org/uniprot/D3Z6G7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z6G7-1", "url": "https://www.uniprot.org/uniprot/D3Z6G7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNPRVIRLWLPSAVLLSLVPGHFPVRGPSTVTGTVGESLSVSCQYEKKLKTKKKIWCKWKSNVLCKDIVKTSASEEARNGRVSIRDHPDNLTFTVTLENLTLEDAGTYMCMVDIGFFYDAYLQIDKSFKVEVFVVPGKPPFKGSRPGNGINILASPTSSAVHTQPNVTTDDTIPAPSPELRSLLSSPHFWILVSLKLPLFLSMLGALLWVNRPQRCSGGSSAWPCYENQ", "length": 229, "header": "sp|A2A7V7-1|CLM6_MOUSE Isoform 1 of CMRF35-like molecule 6 OS=Mus musculus OX=10090 GN=Cd300c PE=2 SV=1 CANONICAL=A2A7V7-1" }, "isoforms": [ { "isoform_ac": "A2A7V7-1", "url": "https://www.uniprot.org/uniprotkb/A2A7V7/entry#A2A7V7-1", "sequence": { "sequence": "MNPRVIRLWLPSAVLLSLVPGHFPVRGPSTVTGTVGESLSVSCQYEKKLKTKKKIWCKWKSNVLCKDIVKTSASEEARNGRVSIRDHPDNLTFTVTLENLTLEDAGTYMCMVDIGFFYDAYLQIDKSFKVEVFVVPGKPPFKGSRPGNGINILASPTSSAVHTQPNVTTDDTIPAPSPELRSLLSSPHFWILVSLKLPLFLSMLGALLWVNRPQRCSGGSSAWPCYENQ", "length": 229, "header": "sp|A2A7V7-1|CLM6_MOUSE Isoform 1 of CMRF35-like molecule 6 OS=Mus musculus OX=10090 GN=Cd300c PE=2 SV=1 CANONICAL=A2A7V7-1" }, "locus": {} }, { "isoform_ac": "D3Z6G7-1", "url": "https://www.uniprot.org/uniprotkb/A2A7V7/entry#D3Z6G7-1", "sequence": { "sequence": "MNPRVIRLWLPSAVLLSLVSDMHGGHFPVRGPSTVTGTVGESLSVSCQYEKKLKTKKKIWCKWKSNVLCKDIVKTSASEEARNGRVSIRDHPDNLTFTVTLENLTLEDAGTYMCMVDIGFFYDAYLQIDKSFKVEVFVVPVKGSRPGNGINILASPTSSAVHTQPNVTTDDTIPAPSPELRSLLSSPHFWILVSLKLPLFLSMLGALLWVNRPQRCSGGSSAWPCYENQ", "length": 229, "header": "tr|D3Z6G7-1|D3Z6G7_MOUSE Computationally mapped isoform of CD300C molecule OS=Mus musculus OX=10090 GN=Cd300c PE=3 SV=3 CANONICAL=A2A7V7-1" }, "locus": { "chromosome": "11", "start_pos": 114851243, "end_pos": 114847107, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000092466.13", "url": "https://www.ensembl.org/id/ENSMUST00000092466.13" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000090123.7", "url": "https://www.ensembl.org/id/ENSMUSP00000090123.7" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "A2A7V7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2A7V7#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 99, "start_aa": "Asn", "end_pos": 99, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn99", "evidence": [ { "id": "A2A7V7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2A7V7#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "CMRF-35-like molecule-1, a novel mouse myeloid receptor, can inhibit osteoclast formation.", "journal": "J. Immunol.", "date": "2003", "authors": "Chung DH, Humphrey MB, Nakamura MC, Ginzinger DG, Seaman WE, Daws MR", "evidence": [ { "database": "UniProtKB", "id": "A2A7V7", "url": "https://www.uniprot.org/uniprot/A2A7V7" } ], "reference": [ { "type": "PubMed", "id": "14662855", "url": "https://glygen.org/publication/PubMed/14662855" } ] } ], "pathway": [ { "id": "R-MMU-198933", "name": "Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-198933", "resource": "Reactome", "description": "Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A2A7V7", "url": "https://www.uniprot.org/uniprot/A2A7V7" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A2A7V7", "url": "https://www.uniprot.org/uniprot/A2A7V7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immune system process", "id": "GO:0002376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002376", "evidence": [ { "database": "UniProtKB", "id": "A2A7V7", "url": "https://www.uniprot.org/uniprot/A2A7V7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 166, "end_pos": 168, "annotation": "n_glycosylation_sequon" }, { "start_pos": 90, "end_pos": 92, "annotation": "n_glycosylation_sequon" }, { "start_pos": 99, "end_pos": 101, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [ 90, 99 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 166, "end_pos": 168 }, { "start_pos": 90, "end_pos": 92 }, { "start_pos": 99, "end_pos": 101 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }