{ "uniprot_canonical_ac": "A1ZB64-1", "uniprot_ac": "A1ZB64", "uniprot_id": "BOM06_DROME", "mass": { "chemical_mass": 4190.0, "monoisotopic_mass": 4190.0 }, "refseq": { "ac": "NP_788402", "name": "bomanin short 6", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_788402" }, "gene_names": [ { "name": "BomS6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A1ZB64", "id": "A1ZB64" }, { "name": "Bom068; CG15068; CT34939; Dmel\\CG15068", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_788402", "id": "NP_788402" }, { "name": "Bom068", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A1ZB64", "id": "A1ZB64" }, { "name": "BomS6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_788402", "id": "NP_788402" }, { "name": "CG15068", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A1ZB64", "id": "A1ZB64" } ], "protein_names": [ { "name": "Bomanin Short 6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A1ZB64/entry#names_and_taxonomy", "id": "A1ZB64" }, { "name": "Bomanin-068", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A1ZB64/entry#names_and_taxonomy", "id": "A1ZB64" }, { "name": "CG15068-PA; BomS6-PA; bomanin S6; bomanin 068", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_788402", "id": "NP_788402" }, { "name": "bomanin short 6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_788402", "id": "NP_788402" } ], "function": [ { "annotation": "Secreted immune-induced peptide induced by Toll signaling. Has a role in resistance to bacterial and fungal infections (PubMed:25915418, PubMed:29920489). The strength of antimicrobial activity appears to correlate with the overall level of expression (PubMed:29920489).", "evidence": [ { "database": "UniProtKB", "id": "A1ZB64", "url": "https://www.uniprot.org/uniprot/A1ZB64#function" }, { "database": "PubMed", "id": "29920489", "url": "https://glygen.org/publication/PubMed/29920489" }, { "database": "PubMed", "id": "25915418", "url": "https://glygen.org/publication/PubMed/25915418" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "A1ZB64", "url": "https://www.uniprot.org/uniprot/A1ZB64" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "gene": [ { "name": "BomS6", "url": "https://www.uniprot.org/uniprot/A1ZB64", "locus": { "chromosome": "2R", "start_pos": 18390353, "end_pos": 18390629, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0040733", "url": "https://www.ensembl.org/id/FBgn0040733" } ] } } ], "crossref": [ { "id": "FBgn0040733", "url": "https://bgee.org/?page=gene&gene_id=FBgn0040733", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FBgn0040733", "url": "https://flybase.org/reports/FBgn0040733", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "50206", "url": "https://www.ncbi.nlm.nih.gov/gene/50206", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "A1ZB64", "url": "https://www.ebi.ac.uk/intact/interactors/id:A1ZB64*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR013172", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013172", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG15068", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG15068", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PF08194", "url": "http://pfam.xfam.org/family/PF08194", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A1ZB64", "url": "http://purl.obolibrary.org/obo/PR_A1ZB64", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_788402", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_788402", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A1ZB64", "url": "https://www.uniprot.org/uniprot/A1ZB64", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A1ZB64-1", "url": "https://www.uniprot.org/uniprot/A1ZB64-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKLLSITFLFGLLALASANPLSPGNVIINGDCKVCNIRGD", "length": 40, "header": "sp|A1ZB64-1|BOM06_DROME Isoform 1 of Bomanin Short 6 OS=Drosophila melanogaster OX=7227 GN=BomS6 PE=3 SV=1 CANONICAL=A1ZB64-1" }, "isoforms": [ { "isoform_ac": "A1ZB64-1", "url": "https://www.uniprot.org/uniprotkb/A1ZB64/entry#A1ZB64-1", "sequence": { "sequence": "MKLLSITFLFGLLALASANPLSPGNVIINGDCKVCNIRGD", "length": 40, "header": "sp|A1ZB64-1|BOM06_DROME Isoform 1 of Bomanin Short 6 OS=Drosophila melanogaster OX=7227 GN=BomS6 PE=3 SV=1 CANONICAL=A1ZB64-1" }, "locus": { "chromosome": "2R", "start_pos": 18390593, "end_pos": 18390395, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0086727", "url": "https://www.ensembl.org/id/FBtr0086727" }, { "database": "Ensembl Peptide", "id": "FBpp0085906", "url": "https://www.ensembl.org/id/FBpp0085906" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "A1ZB64", "url": "https://www.uniprot.org/uniprot/A1ZB64" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "A1ZB64", "url": "https://www.uniprot.org/uniprot/A1ZB64" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "An effector Peptide family required for Drosophila toll-mediated immunity.", "journal": "PLoS pathogens", "date": "2015-04", "authors": "Clemmons Alexa W, Lindsay Scott A, Wasserman Steven A", "evidence": [ { "database": "UniProtKB", "id": "A1ZB64", "url": "https://www.uniprot.org/uniprot/A1ZB64" } ], "reference": [ { "type": "PubMed", "id": "25915418", "url": "https://glygen.org/publication/PubMed/25915418" } ] }, { "title": "Short-Form Bomanins Mediate Humoral Immunity in Drosophila.", "journal": "Journal of innate immunity", "date": "2018", "authors": "Lindsay Scott A, Lin Samuel J H, Wasserman Steven A", "evidence": [ { "database": "UniProtKB", "id": "A1ZB64", "url": "https://www.uniprot.org/uniprot/A1ZB64" } ], "reference": [ { "type": "PubMed", "id": "29920489", "url": "https://glygen.org/publication/PubMed/29920489" } ] } ], "pathway": [ { "id": "dme:Dmel_CG15068", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG15068", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A1ZB64", "url": "https://www.uniprot.org/uniprot/A1ZB64" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "A1ZB64", "url": "https://www.uniprot.org/uniprot/A1ZB64" } ], "pmid": "" }, { "name": "response to mycotoxin", "id": "GO:0010046", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010046", "evidence": [ { "database": "UniProtKB", "id": "A1ZB64", "url": "https://www.uniprot.org/uniprot/A1ZB64" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }