{ "uniprot_canonical_ac": "A1L3C1-1", "uniprot_ac": "A1L3C1", "uniprot_id": "GAR5A_MOUSE", "mass": { "chemical_mass": 24172.0, "monoisotopic_mass": 24172.0 }, "refseq": { "ac": "NP_082445", "name": "Golgi-associated RAB2 interactor protein 5A isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082445" }, "gene_names": [ { "name": "Garin5a", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A1L3C1", "id": "A1L3C1" }, { "name": "0610007G24Rik; 1700021N13Rik; 1700021P22Rik; Fam71e1; GARI-L5; GARIL5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082445", "id": "NP_082445" }, { "name": "Fam71e1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A1L3C1", "id": "A1L3C1" }, { "name": "Garil5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A1L3C1", "id": "A1L3C1" }, { "name": "Garin5a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082445", "id": "NP_082445" } ], "protein_names": [ { "name": "Golgi-associated RAB2 interactor protein 5A", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A1L3C1/entry#names_and_taxonomy", "id": "A1L3C1" }, { "name": "GARIL5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A1L3C1/entry#names_and_taxonomy", "id": "A1L3C1" }, { "name": "Golgi-associated RAB2 interactor protein 5A isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082445", "id": "NP_082445" }, { "name": "Golgi-associated RAB2B interactor-like 5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A1L3C1/entry#names_and_taxonomy", "id": "A1L3C1" }, { "name": "Golgi-associated Rab2B interactor-like 5; Protein FAM71E1; family with sequence similarity 71, member E1; Golgi associated RAB2 interactor protein 5A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082445", "id": "NP_082445" } ], "function": [ { "annotation": "RAB2B effector protein which promotes cytosolic DNA-induced innate immune responses. Regulates IFN responses against DNA viruses by regulating the CGAS-STING signaling axis.", "evidence": [ { "database": "UniProtKB", "id": "A1L3C1", "url": "https://www.uniprot.org/uniprot/A1L3C1#function" }, { "database": "PubMed", "id": "28930687", "url": "https://glygen.org/publication/PubMed/28930687" } ] }, { "annotation": "The RAB2B-GARIL5 complex promotes IFN responses against DNA viruses by regulating the cGAS-STING signaling axis.", "evidence": [ { "database": "RefSeq", "id": "NP_082445", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082445" }, { "database": "PubMed", "id": "28930687", "url": "https://glygen.org/publication/PubMed/28930687" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A1L3C1", "url": "https://www.uniprot.org/uniprot/A1L3C1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "gene": [ { "name": "Garin5a", "url": "https://www.uniprot.org/uniprot/A1L3C1", "locus": { "chromosome": "7", "start_pos": 44150910, "end_pos": 44146005, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000051113", "url": "https://www.ensembl.org/id/ENSMUSG00000051113" } ] } } ], "crossref": [ { "id": "ENSMUSG00000051113", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000051113", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "75538", "url": "https://www.ncbi.nlm.nih.gov/gene/75538", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR022168", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022168", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:75538", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:75538", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1922788", "url": "http://www.informatics.jax.org/marker/MGI:1922788", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "VQFCPHI", "url": "https://omabrowser.org/oma/group/VQFCPHI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4589933at2759", "url": "http://www.orthodb.org/?query=4589933at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR22574", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22574", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22574:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22574:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF12480", "url": "http://pfam.xfam.org/family/PF12480", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A1L3C1", "url": "http://purl.obolibrary.org/obo/PR_A1L3C1", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_082445", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082445", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0U1RNU0", "url": "https://www.uniprot.org/uniprot/A0A0U1RNU0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0U1RNU0-1", "url": "https://www.uniprot.org/uniprot/A0A0U1RNU0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0U1RNX3", "url": "https://www.uniprot.org/uniprot/A0A0U1RNX3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0U1RNX3-1", "url": "https://www.uniprot.org/uniprot/A0A0U1RNX3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A1L3C1", "url": "https://www.uniprot.org/uniprot/A1L3C1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A1L3C1-1", "url": "https://www.uniprot.org/uniprot/A1L3C1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A1L3C1-2", "url": "https://www.uniprot.org/uniprot/A1L3C1-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKGGRDLKAARGGADRPLAPAYAPCRPGRLQRHLLSGEFDQLRDFPIFESNFVQVTRFGEVANKVTMGVAASSPALELPDLLLLAGPDKENGHLQLLGLFPLQFVQLFVHDESRQQLKVKFRTGRAFYLQLRSPPETRDCEFGRWVRLLYRLRFHSPTCAVPFTHEDTAPEEEEEEEEEEEEEEVKEGQLQPPEFQATEARLDPQVSELWGL", "length": 212, "header": "sp|A1L3C1-1|GAR5A_MOUSE Isoform 1 of Golgi-associated RAB2 interactor protein 5A OS=Mus musculus OX=10090 GN=Garin5a PE=1 SV=2 CANONICAL=A1L3C1-1" }, "isoforms": [ { "isoform_ac": "A0A0U1RNU0-1", "url": "https://www.uniprot.org/uniprotkb/A1L3C1/entry#A0A0U1RNU0-1", "sequence": { "sequence": "MKGGRDLKAARGGADRPLAPAYAPCRPGRLQRHLLSGEFDQLRDFPIFESNFVQVTRFGEVANKVTMGVAASSPALELPDLLLLAGPDKENGHLQLLGLFPLQFVQLFVHDESRQQLKVKFRTGRAFYLQLRSPPETRDCEFGRWVRLLYRLRFHSPTCAVPFTHEDTAPEEEEEEEEEEEEEEVKEGQLQPPEVRAGPRAQGCWARKDGKGPGRPAGAWTPGSEGGGLGPRPLGLRKENQSWISRPKEKGTPPFFHLLRGSKEKATGSAAD", "length": 272, "header": "tr|A0A0U1RNU0-1|GAR5A_MOUSE Computationally mapped isoform of Golgi-associated RAB2 interactor protein 5A OS=Mus musculus OX=10090 GN=Garin5a PE=1 SV=1 CANONICAL=A1L3C1-1" }, "locus": { "chromosome": "7", "start_pos": 44150096, "end_pos": 44146112, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000205359.2", "url": "https://www.ensembl.org/id/ENSMUST00000205359.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000145700.2", "url": "https://www.ensembl.org/id/ENSMUSP00000145700.2" } ] } }, { "isoform_ac": "A0A0U1RNX3-1", "url": "https://www.uniprot.org/uniprotkb/A1L3C1/entry#A0A0U1RNX3-1", "sequence": { "sequence": "MKGGRDLKAARGGADRPLAPAYAPCRPGRLQRHLLSGEFDQLRDFPIFESNFVQVWSPGPPTR", "length": 63, "header": "tr|A0A0U1RNX3-1|GAR5A_MOUSE Computationally mapped isoform of Golgi-associated RAB2 interactor protein 5A OS=Mus musculus OX=10090 GN=Garin5a PE=1 SV=1 CANONICAL=A1L3C1-1" }, "locus": { "chromosome": "7", "start_pos": 44146484, "end_pos": 44146112, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000205422.2", "url": "https://www.ensembl.org/id/ENSMUST00000205422.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000146329.2", "url": "https://www.ensembl.org/id/ENSMUSP00000146329.2" } ] } }, { "isoform_ac": "A1L3C1-1", "url": "https://www.uniprot.org/uniprotkb/A1L3C1/entry#A1L3C1-1", "sequence": { "sequence": "MKGGRDLKAARGGADRPLAPAYAPCRPGRLQRHLLSGEFDQLRDFPIFESNFVQVTRFGEVANKVTMGVAASSPALELPDLLLLAGPDKENGHLQLLGLFPLQFVQLFVHDESRQQLKVKFRTGRAFYLQLRSPPETRDCEFGRWVRLLYRLRFHSPTCAVPFTHEDTAPEEEEEEEEEEEEEEVKEGQLQPPEFQATEARLDPQVSELWGL", "length": 212, "header": "sp|A1L3C1-1|GAR5A_MOUSE Isoform 1 of Golgi-associated RAB2 interactor protein 5A OS=Mus musculus OX=10090 GN=Garin5a PE=1 SV=2 CANONICAL=A1L3C1-1" }, "locus": { "chromosome": "7", "start_pos": 44150445, "end_pos": 44146112, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000107927.5", "url": "https://www.ensembl.org/id/ENSMUST00000107927.5" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000103560.4", "url": "https://www.ensembl.org/id/ENSMUSP00000103560.4" } ] } }, { "isoform_ac": "A1L3C1-2", "url": "https://www.uniprot.org/uniprotkb/A1L3C1/entry#A1L3C1-2", "sequence": { "sequence": "MGVAASSPALELPDLLLLAGPDKENGHLQLLGLFPLQFVQLFVHDESRQQLKVKFRTGRAFYLQLRSPPETRDCEFGRWVRLLYRLRFHSPTCAVPFTHEDTAPEEEEEEEEEEEEEEVKEGQLQPPEFQATEARLDPQVSELWGL", "length": 146, "header": "sp|A1L3C1-2|GAR5A_MOUSE Isoform 2 of Golgi-associated RAB2 interactor protein 5A OS=Mus musculus OX=10090 GN=Garin5a PE=1 SV=2 CANONICAL=A1L3C1-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Expression of uncharacterized male germ cell-specific genes and discovery of novel sperm-tail proteins in mice.", "journal": "PLoS ONE", "date": "2017", "authors": "Kwon Jun Tae, Ham Sera, Jeon Suyeon, Kim Youil, Oh Seungmin, Cho Chunghee", "evidence": [ { "database": "UniProtKB", "id": "A1L3C1", "url": "https://www.uniprot.org/uniprot/A1L3C1" } ], "reference": [ { "type": "PubMed", "id": "28742876", "url": "https://glygen.org/publication/PubMed/28742876" } ] }, { "title": "The RAB2B-GARIL5 Complex Promotes Cytosolic DNA-Induced Innate Immune Responses.", "journal": "Cell reports", "date": "2017", "authors": "Takahama M, Fukuda M, Ohbayashi N, Kozaki T, Misawa T, Okamoto T, Matsuura Y, Akira S, Saitoh T", "evidence": [ { "database": "UniProtKB", "id": "A1L3C1", "url": "https://www.uniprot.org/uniprot/A1L3C1" }, { "database": "RefSeq", "id": "NP_082445", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082445" } ], "reference": [ { "type": "PubMed", "id": "28930687", "url": "https://glygen.org/publication/PubMed/28930687" } ] } ], "pathway": [ { "id": "mmu:75538", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:75538", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D4A176-1", "protein_name": "Golgi associated RAB2 interactor 5A", "gene_name": "Garin5a", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKGGRDLKPASGRADRPLAQAYAPCRPGRLQRHLLSGEFDQLRDFPIFESNFVQVTRFGEVANKVTMGVAASSPALELPDLLLLAGPDKENGHLQLLGLFPLQFVQLFVHDVSRQQLKVKFRTGRAFYLQLRAPPETRDCEFGRWVRLLYRLRFHSPTCAVPFTHEDTVPEESEDEDEVEEGQLQPPEVRAGPRAQGCWARKDGKGPVSCHRGQTRPAGLRTLGALIQPRSFQITKGPEIKPAQLRAREMDF", "length": 252 }, "evidence": [ { "id": "46374907", "url": "http://www.informatics.jax.org/homology/46374907", "database": "MGI" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "F1RH17-1", "protein_name": "Golgi associated RAB2 interactor 5A", "gene_name": "GARIN5A", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MKPVHQPKPAPGGAGEAGLGGMAERPLFPACPTGRPGRLQRHLLSGEFDQLRDFPIFESNFVQVTRLGEVANKVTMGVAASSPALELPDLLLLAGPAKENGCLQLFGLFPLQFVQLFVHDESRRELKVKFRTGRAFYLQLRAPPETRDREFGQWVRLLYRLRFHSAQGAVPFTQAYSALEDEEEDDDEDDYDEDEDLQAMEARLDPQISELWGL", "length": 214 }, "evidence": [ { "id": "A1L3C1", "url": "https://omabrowser.org/oma/group/A1L3C1/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "Q6IPT2-1", "protein_name": "Golgi-associated RAB2 interactor protein 5A", "gene_name": "GARIN5A", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGPPLWPDLQEPPPPGTSSQIRSPLLCDVIKPAPHHDVTVRVVPPPRFLPLLLRPLPSDGDIAMRRDRGPKPALGGAGEVEPGGMAASPTGRPRRLQRYLQSGEFDQFRDFPIFESNFVQFCPDIYPAPTSDLWPQVTRLGEVANEVTMGVAASSPALELPDLLLLAGPAKENGHLQLFGLFPLKFVQLFVHDKSRCQLEVKLNTSRTFYLQLRAPLKTRDREFGQWVRLLYRLRFLSASAVPFTQE", "length": 247 }, "evidence": [ { "id": "46374907", "url": "http://www.informatics.jax.org/homology/46374907", "database": "MGI" }, { "id": "A1L3C1", "url": "https://omabrowser.org/oma/group/A1L3C1/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "A1L3C1", "url": "https://www.uniprot.org/uniprot/A1L3C1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "A1L3C1", "url": "https://www.uniprot.org/uniprot/A1L3C1" } ], "pmid": "" }, { "name": "defense response to virus", "id": "GO:0051607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051607", "evidence": [ { "database": "UniProtKB", "id": "A1L3C1", "url": "https://www.uniprot.org/uniprot/A1L3C1" } ], "pmid": "" }, { "name": "positive regulation of type I interferon production", "id": "GO:0032481", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032481", "evidence": [ { "database": "UniProtKB", "id": "A1L3C1", "url": "https://www.uniprot.org/uniprot/A1L3C1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }